DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3032 and CG9609

DIOPT Version :9

Sequence 1:NP_001284974.1 Gene:CG3032 / 31648 FlyBaseID:FBgn0029928 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_573161.1 Gene:CG9609 / 32663 FlyBaseID:FBgn0030787 Length:403 Species:Drosophila melanogaster


Alignment Length:332 Identity:84/332 - (25%)
Similarity:133/332 - (40%) Gaps:62/332 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 PP--EPAPDPDPIDEPAIKSDKSPRKSFRGSRNTL-----KCSV--CRRSFAHQITLAAHIRKVH 179
            ||  :.|.|.|.  |.|::..|..    :|.||::     .||:  |..:|.....|..|  :.|
  Fly     2 PPGTQIASDSDM--ETALEEFKQR----QGRRNSIGSAKYACSMPKCEATFKRLDQLDRH--EYH 58

  Fly   180 EGSKRPFQC--DQCEKAYSFMGGLYTHIREVHAPKE----RRHPCDQPGCERIYTSRIAMQKHKR 238
            ....:...|  :.|:|.||.:..|..|:|..|...|    :...|....|.:::.|...|.:|.|
  Fly    59 HTGIKKHACSYEGCDKTYSIVTHLKRHLRSTHERPESAAKKTVKCALEECSKMFISVSNMTRHMR 123

  Fly   239 LKH-SPRDRDALKKFICEQCGASFNQSANLKYHLKTKHPTEDEVAAREGGAGERHFCDICQKEFH 302
            ..| ||      |.:.|.||.|.|:|...||.|...:|..|           ..:.|..|.:.|:
  Fly   124 ETHESP------KVYPCSQCSAKFSQKLKLKRHEIREHTLE-----------YPYSCSKCSRGFY 171

  Fly   303 SRYTLKYHTLQQHEVQEELPHECQVCGRRMAKKFMLLQHM--LMHSNDKLPCEHCGRRFARRFEL 365
            .::     ..|.||...:| :||..|..:..|..:..:|.  .:|..::..|:.|...|.:..||
  Fly   172 QQW-----QCQSHEPSCKL-YECPGCPLQFDKWTLYTKHCRDSLHGKNRHKCDRCDSAFDKPSEL 230

  Fly   366 EAHVRAVHLK-------LKPFPCHH--CPESFASRKTLRHHEY-IHTGEKPYICDT--CGQAFRQ 418
            :.|:...|.:       ...|.|:.  |.:|::..:.||.|.. .|:|.: :.|..  ||:.|..
  Fly   231 KRHLEVKHKEAAQTDECATSFTCNEEGCGKSYSYLRNLRQHMLTAHSGRR-FECQALDCGRCFSS 294

  Fly   419 QTCLKNH 425
            ...|..|
  Fly   295 AQNLARH 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3032NP_001284974.1 zf-AD 13..95 CDD:285071
C2H2 Zn finger 158..179 CDD:275368 6/22 (27%)
C2H2 Zn finger 188..209 CDD:275368 8/22 (36%)
C2H2 Zn finger 218..239 CDD:275368 5/20 (25%)
C2H2 Zn finger 254..275 CDD:275368 9/20 (45%)
C2H2 Zn finger 294..315 CDD:275368 4/20 (20%)
C2H2 Zn finger 325..345 CDD:275368 4/21 (19%)
C2H2 Zn finger 352..373 CDD:275368 6/20 (30%)
C2H2 Zn finger 381..401 CDD:275368 6/22 (27%)
C2H2 Zn finger 409..429 CDD:275368 6/19 (32%)
CG9609NP_573161.1 C2H2 Zn finger 40..59 CDD:275368 4/20 (20%)
zf-C2H2_8 67..150 CDD:292531 28/88 (32%)
C2H2 Zn finger 67..90 CDD:275368 8/22 (36%)
C2H2 Zn finger 106..126 CDD:275368 5/19 (26%)
C2H2 Zn finger 134..155 CDD:275368 9/20 (45%)
C2H2 Zn finger 188..210 CDD:275368 4/21 (19%)
C2H2 Zn finger 217..237 CDD:275368 6/19 (32%)
C2H2 Zn finger 253..276 CDD:275368 6/22 (27%)
C2H2 Zn finger 283..302 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.