DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3032 and CG2129

DIOPT Version :9

Sequence 1:NP_001284974.1 Gene:CG3032 / 31648 FlyBaseID:FBgn0029928 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_572449.1 Gene:CG2129 / 31741 FlyBaseID:FBgn0030008 Length:465 Species:Drosophila melanogaster


Alignment Length:395 Identity:94/395 - (23%)
Similarity:155/395 - (39%) Gaps:114/395 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 REEDQESLHGLEPPEPAP-----------------DPDPIDEPAIKSDKSPRKSFRGSRNTLKCS 159
            :|.|:|.    ||..|.|                 :.|..||..:...:...:..|..|:.:|..
  Fly    73 QERDRER----EPNSPVPIVAQVNPFAWYEIGGDHNEDSDDERVVLEKQDEDEDERPGRSIIKWQ 133

  Fly   160 VCRRSFAHQITLAAHIRKV--------HEGSKRPFQCDQCEKAYSFMGGLYTHIREVHAPKERRH 216
                  .||...:..:|:|        .|.|::    ::|        |:     |:....|.||
  Fly   134 ------DHQSLTSESLRQVRALKVDYKEEDSEQ----EEC--------GM-----ELDLDSEGRH 175

  Fly   217 ----PCDQPGCERIYTSRIAMQKHKRLKHS----------------PRD---RDALKKFICEQCG 258
                |...|.|.::|.||..:::|...:|.                |:|   :.|.:::.||.||
  Fly   176 SAKIPHSCPHCTKVYQSRKVLERHIMRQHKDTLSPDVDSEDADYEPPKDAPVKSAAQEYKCEHCG 240

  Fly   259 ASFNQSANLKYHLKTKHPTEDE------------------------VAAREGGAGERHFCDICQK 299
            ..::...:|:.|||..|...:|                        :....|||.    |.:|.:
  Fly   241 KIYHGKYSLRQHLKRDHDNGEEGGSAIFTCLECEAQLPRLRLLDEHMVQAHGGAA----CVVCGR 301

  Fly   300 EFHSRYTLKYHTLQQHEVQEELPHECQVCGRRMAKKFMLLQHM----LMHSNDK-LPCEHCGRRF 359
            .:.:|:.||.|.| :|..:..:|.....||    |:|..::||    .:|:..| ..||.||...
  Fly   302 RYKTRHELKRHQL-KHTSERNVPCPHPGCG----KRFFTIRHMRNHGKVHTEQKNFVCESCGYSC 361

  Fly   360 ARRFELEAHVRAVHLKLKPFPCHHCPESFASRKTLRHHEYIHTGEKPYICDTCGQAFRQQTCLKN 424
            ..:..|..|:|: |...:||.|..|.:.|.|...||.|..:|:.|:|::|..||..|.:|..|.:
  Fly   362 RNKETLRVHIRS-HTGERPFGCQVCDKRFPSHSGLREHMAMHSTERPHVCSVCGATFSRQKGLYH 425

  Fly   425 HRKVH 429
            |:.:|
  Fly   426 HKFLH 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3032NP_001284974.1 zf-AD 13..95 CDD:285071
C2H2 Zn finger 158..179 CDD:275368 4/28 (14%)
C2H2 Zn finger 188..209 CDD:275368 3/20 (15%)
C2H2 Zn finger 218..239 CDD:275368 6/20 (30%)
C2H2 Zn finger 254..275 CDD:275368 8/20 (40%)
C2H2 Zn finger 294..315 CDD:275368 7/20 (35%)
C2H2 Zn finger 325..345 CDD:275368 6/23 (26%)
C2H2 Zn finger 352..373 CDD:275368 7/20 (35%)
C2H2 Zn finger 381..401 CDD:275368 7/19 (37%)
C2H2 Zn finger 409..429 CDD:275368 7/19 (37%)
CG2129NP_572449.1 C2H2 Zn finger 296..316 CDD:275370 7/20 (35%)
zf-C2H2_8 323..411 CDD:292531 29/92 (32%)
C2H2 Zn finger 327..346 CDD:275368 6/22 (27%)
C2H2 Zn finger 354..374 CDD:275368 7/20 (35%)
zf-H2C2_2 367..389 CDD:290200 8/22 (36%)
C2H2 Zn finger 382..402 CDD:275368 7/19 (37%)
zf-H2C2_2 395..419 CDD:290200 10/23 (43%)
C2H2 Zn finger 410..430 CDD:275368 7/19 (37%)
C2H2 Zn finger 438..458 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440022
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.