DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3032 and CG11398

DIOPT Version :9

Sequence 1:NP_001284974.1 Gene:CG3032 / 31648 FlyBaseID:FBgn0029928 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_001259122.2 Gene:CG11398 / 31070 FlyBaseID:FBgn0040366 Length:329 Species:Drosophila melanogaster


Alignment Length:278 Identity:67/278 - (24%)
Similarity:99/278 - (35%) Gaps:76/278 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 RGSRNTLKCSVCRRSFAHQITLAAHIRKVHEGSKRPFQCDQCEKAYSFMGGLYTHIREVHAPKER 214
            :|...:..|..|...|..:..||||         ||        .:.:.||..|...|       
  Fly    44 QGGSPSFVCRRCPALFLTREELAAH---------RP--------THRYQGGQQTPASE------- 84

  Fly   215 RHPCDQPGCERIYTSRIAMQKHKRLKHSPRDRDALKKFICEQCGASFNQSANLKYHLKTKHPTED 279
             |.||  .|.|::      |||..|.......:.::.:.|.:|.|.|.|.:|.:.|||..|....
  Fly    85 -HACD--ACGRVF------QKHNALVDHMNAHNDVRNYPCPECPARFVQRSNRECHLKNVHRKVY 140

  Fly   280 EVAAREGGAGERHFCDICQKEFHSRYTLKYHTLQQHEVQEELPHECQVCGRRMAKKFMLLQHM-L 343
            ..:..|.|         |:|.|..|                  .||.             ||: .
  Fly   141 LHSCPEPG---------CKKRFQQR------------------RECD-------------QHVKT 165

  Fly   344 MHSNDK-LPCEHCGRRFARRFELEAHVRAVHLKLKPFPCHHCPESFASRKTLRHHEYIHTGEKPY 407
            :|.|:: |.|:.|..||:.......|: |.|...|.:.|..|.:.|...:....|.::|:..|.|
  Fly   166 VHQNERNLVCDTCSARFSHPVNYRKHL-ASHGSAKSYGCPICGKLFGRPENRDVHLFVHSICKAY 229

  Fly   408 ICDTCGQAFRQQTCLKNH 425
            ||..||..:.::..|..|
  Fly   230 ICSVCGADYMRRNQLIRH 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3032NP_001284974.1 zf-AD 13..95 CDD:285071
C2H2 Zn finger 158..179 CDD:275368 7/20 (35%)
C2H2 Zn finger 188..209 CDD:275368 4/20 (20%)
C2H2 Zn finger 218..239 CDD:275368 7/20 (35%)
C2H2 Zn finger 254..275 CDD:275368 9/20 (45%)
C2H2 Zn finger 294..315 CDD:275368 4/20 (20%)
C2H2 Zn finger 325..345 CDD:275368 3/20 (15%)
C2H2 Zn finger 352..373 CDD:275368 6/20 (30%)
C2H2 Zn finger 381..401 CDD:275368 4/19 (21%)
C2H2 Zn finger 409..429 CDD:275368 5/17 (29%)
CG11398NP_001259122.2 C2H2 Zn finger 52..72 CDD:275368 9/36 (25%)
C2H2 Zn finger 87..107 CDD:275368 8/27 (30%)
C2H2 Zn finger 115..136 CDD:275368 9/20 (45%)
C2H2 Zn finger 144..165 CDD:275368 10/60 (17%)
C2H2 Zn finger 175..195 CDD:275368 6/20 (30%)
C2H2 Zn finger 203..223 CDD:275368 4/19 (21%)
C2H2 Zn finger 231..247 CDD:275368 4/15 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.