DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3032 and mld

DIOPT Version :9

Sequence 1:NP_001284974.1 Gene:CG3032 / 31648 FlyBaseID:FBgn0029928 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_001247289.1 Gene:mld / 2768685 FlyBaseID:FBgn0263490 Length:1965 Species:Drosophila melanogaster


Alignment Length:467 Identity:101/467 - (21%)
Similarity:161/467 - (34%) Gaps:120/467 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LQLEKE------PLKTELQSDEIPISQELQQLLNINLSQDVENQDADQQWLPNELCLECRSAVQN 77
            ||:..|      |.|..||..:    .:||....:.:.|..:.|.|.|| ||.         .|:
  Fly  1463 LQITSERRPRGRPYKPRLQLQQ----HQLQPQQKLQVQQHQQQQKALQQ-LPQ---------AQH 1513

  Fly    78 FEKFRRKADECRKQLLEMLKKDPREPTFEVVYDGREEDQESLHGLEPPE------PAPDPDPIDE 136
            .::      :.:.||.:.:.:..::...:|.....::.|:.|...:|.:      .:|.|..::.
  Fly  1514 HQQ------QQQPQLQQEVLQQVQQLQVQVQPQQHQQHQQVLQVQQPQQQPLMQPQSPHPSTVEM 1572

  Fly   137 PAIKSDKSPRKSFRGSRNTLKCSVCRRSFAHQITLAAHIRKVHEGSKRPFQCDQCEKAYSFMGGL 201
            .|  |..:|||       .|.|.                           .|:.|...:|.....
  Fly  1573 QA--SPTTPRK-------ILCCP---------------------------DCEDCTSGHSHANEQ 1601

  Fly   202 YTHIREVHAPKE--------RRHPCDQPGCERIYTSRIAMQKHKRLKHSPRDRDALKKFICEQCG 258
            :..::.:.||..        ...|..||   .:|:..|.|...:  :..|.....|:::  .:.|
  Fly  1602 FEELQTLQAPPTVLTPPSTIVSVPSPQP---MVYSQHITMPSPE--QSEPDSTTTLRQY--RKRG 1659

  Fly   259 ASFNQSANLKYHLKT----------------KH--------------PTEDEVAAREGGAGER-- 291
            ........|  ||.|                .|              |....||:....:..|  
  Fly  1660 VIVGPQGPL--HLATPVASPSPSSSPSSSTVDHIPPASPATPASPAPPPSPAVASTVQVSELRTS 1722

  Fly   292 HFCDICQKEFHSRYTLKYHTLQQHEVQEELPHECQVCGRRMAKKFMLLQHMLMHSNDKLP--CEH 354
            |.|..|::.|.:..:||.|....|.....:|:.|.:|.|....:..|.:||..|..:..|  |..
  Fly  1723 HHCLYCEERFTNEISLKKHHQLAHGALTTMPYVCTICKRGYRMRTALHRHMESHDVEGRPYECNI 1787

  Fly   355 CGRRFARRFELEAHVRAVHLKLKPFPCHHCPESFASRKTLRHHEYIHTGEKPYICDTCGQAFRQQ 419
            |..||.|..:|..|...|||..||..|..|.:.|.:...|:.|...| ||..|.||.|.:.|...
  Fly  1788 CRVRFPRPSQLTLHKITVHLLSKPHTCDECGKQFGTESALKTHIKFH-GELGYQCDGCDRTFEYL 1851

  Fly   420 TCLKNHRKVHEK 431
            ..|:.||:.|.:
  Fly  1852 KELRKHRRTHSE 1863

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3032NP_001284974.1 zf-AD 13..95 CDD:285071 19/81 (23%)
C2H2 Zn finger 158..179 CDD:275368 1/20 (5%)
C2H2 Zn finger 188..209 CDD:275368 3/20 (15%)
C2H2 Zn finger 218..239 CDD:275368 5/20 (25%)
C2H2 Zn finger 254..275 CDD:275368 5/36 (14%)
C2H2 Zn finger 294..315 CDD:275368 6/20 (30%)
C2H2 Zn finger 325..345 CDD:275368 6/19 (32%)
C2H2 Zn finger 352..373 CDD:275368 7/20 (35%)
C2H2 Zn finger 381..401 CDD:275368 5/19 (26%)
C2H2 Zn finger 409..429 CDD:275368 7/19 (37%)
mldNP_001247289.1 zf-AD 186..255 CDD:214871
C2H2 Zn finger 1365..1388 CDD:275368
C2H2 Zn finger 1396..1416 CDD:275368
C2H2 Zn finger 1424..1445 CDD:275368
C2H2 Zn finger 1725..1746 CDD:275368 6/20 (30%)
C2H2 Zn finger 1756..1776 CDD:275368 6/19 (32%)
C2H2 Zn finger 1785..1806 CDD:275368 7/20 (35%)
C2H2 Zn finger 1814..1834 CDD:275368 5/19 (26%)
zf-C2H2 1839..1861 CDD:278523 8/21 (38%)
C2H2 Zn finger 1841..1861 CDD:275368 7/19 (37%)
C2H2 Zn finger 1868..1888 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439970
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.