DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3032 and szy-5

DIOPT Version :9

Sequence 1:NP_001284974.1 Gene:CG3032 / 31648 FlyBaseID:FBgn0029928 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_491745.2 Gene:szy-5 / 172281 WormBaseID:WBGene00016154 Length:603 Species:Caenorhabditis elegans


Alignment Length:563 Identity:109/563 - (19%)
Similarity:161/563 - (28%) Gaps:239/563 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 ADECRK-QL-------LEMLKKDPREPTFEVVYDGREEDQESLHGLEPPEP-----APDPDPIDE 136
            |:.|.| ||       :.:.:...|.|||  .|:...|..|.|    |..|     ..||     
 Worm     2 AESCVKPQLPRPRIPNIRVFQPTTRIPTF--TYEQFNESVEIL----PSRPECLYRRNDP----- 55

  Fly   137 PAIKSDKSPRKSFRGSRNTLKCSVCRRSFAHQITLAAHIRKVHEGSKRPFQCDQCEKAYSFMGGL 201
                :::|.|...|.......|..|.:...:...:..|||| |.|.| |..|..|..::|....|
 Worm    56 ----TNRSYRMKKRPPAQIYHCVQCNKHIKYPSKITEHIRK-HTGEK-PNVCSICNISFSQAHTL 114

  Fly   202 YTHIREVHAPKERRHPCDQPGCE--RIYTSRIAMQKHKRLKHSPRDRDALK-------KFI---- 253
            .||::: || .|:.:.|.....|  .:|......::|   .|.|...:.::       :||    
 Worm   115 KTHMQQ-HA-HEKPYKCSFCTAEFLNVYEKNEHEEQH---MHHPNHGETMEENNATTSQFIQVAE 174

  Fly   254 ------------C-EQCGASFNQSANLKYHLKTKH------------------------------ 275
                        | |.||....:.|.:..|:...|                              
 Worm   175 PTIQAEPCQIYECSEMCGFQSYEEAEVVEHMTVTHYQQTVQNGLILQDFNGEPEPIYEFYEEQYV 239

  Fly   276 ---PTE-------------------DEVAAREG---------GAGE-----RHFCDIC------- 297
               |||                   :.|.|..|         ..||     ....||.       
 Worm   240 QQVPTEIEETPTIKQQSIPYENLHFEHVEAAPGPSEPHLQVVAEGEILYDGEEIVDISNGKSLKE 304

  Fly   298 -------------------------QKEFHSRYTLKYH---------TLQQH------------- 315
                                     :.|...|..:..:         :|:.|             
 Worm   305 EIQNGDANIYGMIQDLEEEVEDIGNEDEERERVRIMVNPNPPKRGTKSLRDHHEATAATMEMIVD 369

  Fly   316 --------------------------------------------EVQEELP--------HECQVC 328
                                                        :|.|..|        |:|:.|
 Worm   370 ASILELAEPSRHLKQGYPPISKRKNTGKRAENLDWIIDAVAKGVDVSEASPHHRKKPTLHKCEYC 434

  Fly   329 GRRMAKKFMLLQHMLMHSNDK-LPCEHCGRRFARRFELEAHVRAVHLKLKPFPC--HHCPESFAS 390
            ||.......:..||..|:.:| ..||.||..|:::..:..|:|. |...||:.|  ..|.|.|.|
 Worm   435 GRVDKYPSKIRAHMRTHTGEKPFKCEICGMAFSQKTPMRLHLRR-HFDQKPYECDVDGCKERFVS 498

  Fly   391 RKTLRHH-EYIHTGEKPYICDT-CGQAFRQQTCLKNHRKVHEK 431
            ...|:.| |..|..:|.|:|.. ||:.|......|:|.|..|:
 Worm   499 GAILKMHVEKKHLNKKKYVCSRGCGRVFSSAYNQKHHEKKCEQ 541

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3032NP_001284974.1 zf-AD 13..95 CDD:285071 5/17 (29%)
C2H2 Zn finger 158..179 CDD:275368 6/20 (30%)
C2H2 Zn finger 188..209 CDD:275368 6/20 (30%)
C2H2 Zn finger 218..239 CDD:275368 4/22 (18%)
C2H2 Zn finger 254..275 CDD:275368 6/21 (29%)
C2H2 Zn finger 294..315 CDD:275368 5/61 (8%)
C2H2 Zn finger 325..345 CDD:275368 6/19 (32%)
C2H2 Zn finger 352..373 CDD:275368 7/20 (35%)
C2H2 Zn finger 381..401 CDD:275368 8/22 (36%)
C2H2 Zn finger 409..429 CDD:275368 7/20 (35%)
szy-5NP_491745.2 C2H2 Zn finger 73..93 CDD:275368 6/20 (30%)
C2H2 Zn finger 101..121 CDD:275368 6/20 (30%)
C2H2 Zn finger 129..149 CDD:275368 3/19 (16%)
C2H2 Zn finger 431..451 CDD:275368 6/19 (32%)
zf-H2C2_2 445..468 CDD:372612 9/22 (41%)
C2H2 Zn finger 459..479 CDD:275368 7/20 (35%)
C2H2 Zn finger 487..506 CDD:275368 6/18 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.