DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3032 and zgc:173713

DIOPT Version :9

Sequence 1:NP_001284974.1 Gene:CG3032 / 31648 FlyBaseID:FBgn0029928 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_001373793.1 Gene:zgc:173713 / 100137115 ZFINID:ZDB-GENE-080215-19 Length:420 Species:Danio rerio


Alignment Length:371 Identity:114/371 - (30%)
Similarity:174/371 - (46%) Gaps:49/371 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 EKFRRKADECRKQL-LEMLKKDPREPTFEVVYDGREEDQESLHGLEPPEPAPDPDPIDEPAIKSD 142
            |.|..|.::.::|. |.:||::..         |:.|..|....::|.|...|..|.......|.
Zfish    15 ETFTVKKEDLQEQTDLMVLKEETH---------GQNETDEKQQFMKPQEIMTDEKPTLTKKTSSH 70

  Fly   143 KSPRKSFRGSRNTLKCSVCRRSFAHQITLAAHIRKVHEGSKRPFQCDQCEKAYSFMGGLYTHIRE 207
            ..|.||..|.  ...|..||:||:.:..|..|:| ||. .::||.|:||.|::..:.|...|:| 
Zfish    71 GRPWKSKSGC--NFSCKQCRKSFSQKSNLDVHMR-VHT-REQPFTCEQCGKSFGQIQGFKAHMR- 130

  Fly   208 VHAPKERRHPCDQPGCERIYTSRIAMQKHKRLKHSPRDRDALKKFICEQCGASFNQSANLKYHLK 272
            :|. .||:..|.:.|....:....|  .|.|: |:..     |.|.|:|||.||....||..|::
Zfish   131 IHT-GERKFTCQECGKSFYHVGNFA--AHMRI-HTGE-----KPFSCKQCGKSFCHKPNLDVHMR 186

  Fly   273 TKHPTEDEVAAREGG----------------AGERH-FCDICQKEFHSRYTLKYHTLQQHEVQEE 320
            . |..|......:.|                .|:|. .|..|.|.:::..:|..| ::.|  ..|
Zfish   187 V-HTGEKPYTCEQCGKSFGQKQSFNTHMRIHTGKRPCTCQQCGKSYYNARSLAAH-MRTH--TGE 247

  Fly   321 LPHECQVCGRRMAKKFMLLQHMLMHSNDKLP--CEHCGRRFARRFELEAHVRAVHLKLKPFPCHH 383
            .|..|.:|.:..:.|..|:.||.:|:.:| |  ||.||:.|.::.:|:.|:| :|...||:.|..
Zfish   248 RPFSCILCRKSFSLKLTLIAHMRVHAREK-PHTCEQCGKSFGQKQDLDIHMR-IHTGEKPYTCTE 310

  Fly   384 CPESFASRKTLRHHEYIHTGEKPYICDTCGQAFRQQTCLKNHRKVH 429
            |.:||....:|:||...||||||:.|..||::|..:|.||||...|
Zfish   311 CGKSFPHISSLKHHIRTHTGEKPFTCAQCGKSFTTKTSLKNHMNGH 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3032NP_001284974.1 zf-AD 13..95 CDD:285071 5/16 (31%)
C2H2 Zn finger 158..179 CDD:275368 8/20 (40%)
C2H2 Zn finger 188..209 CDD:275368 7/20 (35%)
C2H2 Zn finger 218..239 CDD:275368 4/20 (20%)
C2H2 Zn finger 254..275 CDD:275368 9/20 (45%)
C2H2 Zn finger 294..315 CDD:275368 5/20 (25%)
C2H2 Zn finger 325..345 CDD:275368 6/19 (32%)
C2H2 Zn finger 352..373 CDD:275368 8/20 (40%)
C2H2 Zn finger 381..401 CDD:275368 7/19 (37%)
C2H2 Zn finger 409..429 CDD:275368 9/19 (47%)
zgc:173713NP_001373793.1 COG5048 81..>406 CDD:227381 95/294 (32%)
C2H2 Zn finger 84..104 CDD:275368 8/20 (40%)
C2H2 Zn finger 112..132 CDD:275368 7/20 (35%)
C2H2 Zn finger 140..160 CDD:275368 5/22 (23%)
C2H2 Zn finger 168..188 CDD:275368 9/20 (45%)
C2H2 Zn finger 196..216 CDD:275368 1/19 (5%)
C2H2 Zn finger 224..244 CDD:275368 5/20 (25%)
C2H2 Zn finger 252..272 CDD:275368 6/19 (32%)
C2H2 Zn finger 280..300 CDD:275368 8/20 (40%)
C2H2 Zn finger 308..328 CDD:275368 7/19 (37%)
C2H2 Zn finger 336..356 CDD:275368 9/19 (47%)
C2H2 Zn finger 364..384 CDD:275368
C2H2 Zn finger 392..412 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.