DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3032 and zgc:162936

DIOPT Version :9

Sequence 1:NP_001284974.1 Gene:CG3032 / 31648 FlyBaseID:FBgn0029928 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_001353568.1 Gene:zgc:162936 / 100005727 ZFINID:ZDB-GENE-030131-5253 Length:602 Species:Danio rerio


Alignment Length:398 Identity:118/398 - (29%)
Similarity:179/398 - (44%) Gaps:81/398 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 EKFRRKADECRKQLLEMLKKDPREPTFEVVYDGREEDQESLHGLEPPEP-APDPDPID------- 135
            |.|..|.:| .::...:..:||.|.|..|   |.:|::|.|:.:|..|. ....|.::       
Zfish    15 ETFTVKHEE-TEEAFRVKHEDPEEQTDLV---GLKEEEEELNDMEGKEQCVKHQDFVNVEQFIKI 75

  Fly   136 EPAIKSDKSPRKSFRGSRNTL-KCSVCRRSFAHQITLAAHIRKVHEGSKRPFQCDQCEKAYSFMG 199
            ||. .|.|:.:|:   ..|.| .|..|.|:|:.:..|..|: .:|.|.| ||.|:||.|::::..
Zfish    76 EPT-SSGKTDQKN---KPNQLFICQQCGRAFSRKYKLKNHM-TIHTGEK-PFTCEQCGKSFNYKE 134

  Fly   200 GLYTHIREVHAPKERRHPCDQPGCERIYTSRIAMQKHKRLKHSPRDRDALKKFICEQCGASFNQS 264
            .|..|:| ||. .||...|.:  |.:.:..:.|::.|.|: |:..     |.|.||.||.|:...
Zfish   135 NLNYHMR-VHT-GERPFSCKE--CGKSFVHKAALKYHTRV-HTGE-----KPFTCELCGKSYVHK 189

  Fly   265 ANLKYHLKTKHPTEDEVAAREGGAGERHF-CDICQKEFHSRYTLKYHTLQQHEVQE--------- 319
            .||.||             :.|..|||.| |:.|.|.|..::.|..|.| .|..::         
Zfish   190 GNLNYH-------------KRGHTGERPFTCEQCGKSFVQKHKLNNHIL-SHTGEKPFKCLQCGT 240

  Fly   320 -----------------ELPHECQVCGRRMAKKFMLLQHMLMHSNDKL-PCEHCGRRFARRFELE 366
                             |.|..||.||:...||..|.:||.:|:.:.| .||.||:.|..:..|:
Zfish   241 GFSCKANLHTHMKVHSGEKPFTCQQCGKSYTKKSNLKKHMNVHTGENLFRCERCGQSFRYKHSLD 305

  Fly   367 AHVRAVHLK----------LKPFPCHHCPESFASRKTLRHHEYIHTGEKPYICDTCGQAFRQQTC 421
            :|::...|.          .||:.|..|.:|:.::.....|..||.||||:.||.||.:|..:..
Zfish   306 SHIQKRELSGGNCLIKYTAEKPYACQLCDKSYKNKTHFDSHMKIHAGEKPFPCDQCGGSFSNKAA 370

  Fly   422 LKNHRKVH 429
            |.:|.|||
Zfish   371 LGSHMKVH 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3032NP_001284974.1 zf-AD 13..95 CDD:285071 4/15 (27%)
C2H2 Zn finger 158..179 CDD:275368 6/20 (30%)
C2H2 Zn finger 188..209 CDD:275368 7/20 (35%)
C2H2 Zn finger 218..239 CDD:275368 4/20 (20%)
C2H2 Zn finger 254..275 CDD:275368 9/20 (45%)
C2H2 Zn finger 294..315 CDD:275368 7/20 (35%)
C2H2 Zn finger 325..345 CDD:275368 9/19 (47%)
C2H2 Zn finger 352..373 CDD:275368 7/20 (35%)
C2H2 Zn finger 381..401 CDD:275368 4/19 (21%)
C2H2 Zn finger 409..429 CDD:275368 8/19 (42%)
zgc:162936NP_001353568.1 C2H2 Zn finger 95..115 CDD:275368 6/20 (30%)
SFP1 <117..200 CDD:227516 33/106 (31%)
C2H2 Zn finger 123..143 CDD:275368 7/20 (35%)
C2H2 Zn finger 151..171 CDD:275368 5/22 (23%)
C2H2 Zn finger 179..199 CDD:275368 9/32 (28%)
zf-H2C2_2 191..216 CDD:316026 13/37 (35%)
C2H2 Zn finger 207..227 CDD:275368 7/20 (35%)
COG5048 231..597 CDD:227381 43/148 (29%)
C2H2 Zn finger 235..255 CDD:275368 0/19 (0%)
C2H2 Zn finger 263..283 CDD:275368 9/19 (47%)
C2H2 Zn finger 291..308 CDD:275368 6/16 (38%)
C2H2 Zn finger 330..350 CDD:275368 4/19 (21%)
C2H2 Zn finger 358..378 CDD:275368 8/19 (42%)
C2H2 Zn finger 435..455 CDD:275368
C2H2 Zn finger 463..483 CDD:275368
C2H2 Zn finger 491..511 CDD:275368
C2H2 Zn finger 519..539 CDD:275368
C2H2 Zn finger 547..567 CDD:275368
C2H2 Zn finger 575..595 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 44 1.000 Domainoid score I12262
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.