DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cm and stnB

DIOPT Version :9

Sequence 1:NP_001259302.1 Gene:cm / 31647 FlyBaseID:FBgn0000330 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_001036318.2 Gene:stnB / 4379834 FlyBaseID:FBgn0016975 Length:1262 Species:Drosophila melanogaster


Alignment Length:537 Identity:99/537 - (18%)
Similarity:173/537 - (32%) Gaps:181/537 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LFIVNSGGEVFL----------EKHWRSVVSR-------SVCEYFLDAQRAAPYDVPPVIATPHY 52
            |..:..|.|:.|          ::.|:.:|.|       .|.:....|....|:...|:  .|.|
  Fly   722 LHYIGPGWEMQLRQPNKKKITGQRFWKKIVVRLVVQNDVPVVQLLNQAGDKQPFQELPL--QPSY 784

  Fly    53 YLITV---QRDTVSLVAACKQE---------VPPLFVIEFLHRVVDTFQDYFGDCSESVIKDNYV 105
            .:..:   |.|....:...|.:         |.|..|.: ..|:.:....:    ::..|..:|.
  Fly   785 SVSEIGAQQYDQFGKIFTMKLQYIFYKERPGVRPGQVTK-AERITNKLTKF----AQYAIAGDYE 844

  Fly   106 VVYELLDEMLDNGFPL--ATESNILKELIKPPNILRTIANTVTGKSN------VSTTLPSGQLSA 162
            .|.|...::...|.|:  |.:|:.|.::               |..|      .|..:.......
  Fly   845 GVKEFGSDLKKLGLPVEHAPQSSQLFKI---------------GSMNYEDMKQFSVCIEEALFKI 894

  Fly   163 VRWRRSGVRYTNNEAYFDVIEEVDAIIDKSGSTVFAEIQGHIDCCIK------------LSGMPD 215
            ...|...:.|...|.....::|:         ||..:.:|.|   :|            |:|||.
  Fly   895 PALRERALTYKMEEVQVTAVDEI---------TVEQDFEGKI---LKQIARVRLFFLAFLTGMPT 947

  Fly   216 LTLSFMNP----------------------RLFDDVSFHPCVRYKRWEAERLLSFIPPDGNF-RL 257
            :.|...:.                      || :.|.||..|..|.:|..|.:.|.|||.|: .|
  Fly   948 IELGVNDMWRQGKEVVGRHDIIPVATEEWIRL-EAVEFHSVVNQKEYERTRTIKFQPPDANYIEL 1011

  Fly   258 MSYHISSQSVVAIPIYIRHNFSIKTGE-QGRLDLTIGPRNT---LGR-TVDKVKLELTMPRC--- 314
            :.:.:.......:|:.::..:.:...: :.|.|:.: |..|   ||: ..:.|.:...:|.|   
  Fly  1012 LRFRVRPPKNRELPLQLKATWCVSGNKVELRADILV-PGFTSRKLGQIPCEDVSVRFPIPECWIY 1075

  Fly   315 ----------------------------VLNCL---------LTPNQGKYTFDSVTKTLSWDVGR 342
                                        :|..:         :|..|.||  :...:.:.|...|
  Fly  1076 LFRVEKHFRYGSVKSAHRRTGKIKGIERILGAVDTLQESLIEVTSGQAKY--EHHHRAIVWRCPR 1138

  Fly   343 IDVSKLPNIRGSVSITP-------GTTNIDANPS-----VNVQF-----QISQLAVSGLKVNRLD 390
                 ||. .|..:.|.       ..|:.|..||     ..|:|     |:|...|..:.|.  |
  Fly  1139 -----LPK-EGQGAYTTHQLVCRMALTSYDQIPSELAPYAFVEFTMPATQVSHTTVRSVSVQ--D 1195

  Fly   391 MYGEKYKPFKGVKYLTK 407
            ..|:: .|.|.|:||.:
  Fly  1196 SDGDE-PPEKYVRYLAR 1211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cmNP_001259302.1 AP_MHD_Cterm 163..414 CDD:299401 67/342 (20%)
stnBNP_001036318.2 Trypan_PARP 377..496 CDD:114603
AP_MHD_Cterm 897..1219 CDD:299401 67/340 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439811
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10529
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.