DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Inx2 and Inx6

DIOPT Version :9

Sequence 1:NP_001162684.1 Gene:Inx2 / 31646 FlyBaseID:FBgn0027108 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_572374.1 Gene:Inx6 / 31645 FlyBaseID:FBgn0027107 Length:481 Species:Drosophila melanogaster


Alignment Length:406 Identity:116/406 - (28%)
Similarity:196/406 - (48%) Gaps:71/406 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VFGSVKGL---LKIDQVCIDNNVFRMHYKATVIILIAFSLLVTSRQYIGDPIDCIVDEIPLGVMD 65
            ::.:||.|   |::..|.|.:.:|.:|.|.|::||:..:.|::::||.|:||.|:..|.....:.
  Fly     1 MYAAVKPLSNYLRLKTVRIYDPIFTLHSKCTIVILLTCTFLLSAKQYFGEPILCLSSERQADYVQ 65

  Fly    66 TYCWIYSTFTVPERLTGITGRD-----------------------------------VVQPGVGS 95
            :|||...|:.:|..:....|..                                   .:..|||.
  Fly    66 SYCWTMGTYILPAEVDRDGGSSWEYALYAPTSTAAETFNVSSLRALVAQNEQYARFISIAEGVGP 130

  Fly    96 HVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWKSWEGGRLKMLVMDLNSPIVNDECKNDRKK 160
            ...|..:..|.:|||||..:|.||::|||.|.:|||.|||.|::.|..::...::.:.....|.:
  Fly   131 ETRGVTKRMYLRYYQWVFMILLFQSLLFYFPSFLWKVWEGQRMEQLCCEVGDALIVEATYRTRLQ 195

  Fly   161 ILVDYFIGNLNR-HNFYAFRFFVCEALN-FVNVIGQIYFVDFFLDGEFSTYGSDVLKFTELEPDE 223
            :|..||...... |..|:.::..||.|| |:::: ..:.:|...:|.:..|              
  Fly   196 MLTRYFRAQFAPIHWCYSIKYAFCELLNVFISIL-NFWLMDVVFNGFWYKY-------------- 245

  Fly   224 RIDPMA---------------RVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWF 273
             |..:|               ||||||.||....|||||:....|.||||||||:||||:..|:.
  Fly   246 -IHALAAIPVYDWNLWNLMTSRVFPKVAKCEMFVYGPSGTPNIMDILCVLPLNILNEKIFAVLYV 309

  Fly   274 WFIILSIMSGISLIYRIAVVAGPKLRHLLLRARSRLAESEEVELVANKCNIGDWFLLYQLGKNID 338
            ||:.:::::.::::||:.|:..|:||..|||..........|..|......||||:|..:..|::
  Fly   310 WFLFIALLAIMNILYRLLVICCPELRLQLLRTHLNGMPKSHVREVLASAGYGDWFVLMCVSINVN 374

  Fly   339 PLIYKEVISDLSREMS 354
            |.:::|::..|..:::
  Fly   375 PTLFRELLEQLYAKLN 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Inx2NP_001162684.1 Innexin 1..351 CDD:295599 116/401 (29%)
Inx6NP_572374.1 Innexin 21..389 CDD:279248 110/383 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 133 1.000 Domainoid score I3133
eggNOG 1 0.900 - - E1_2BWHM
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I3152
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D323554at33208
OrthoFinder 1 1.000 - - FOG0003274
OrthoInspector 1 1.000 - - mtm4755
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11893
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X282
98.970

Return to query results.
Submit another query.