DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Inx6 and Inx7

DIOPT Version :9

Sequence 1:NP_572374.1 Gene:Inx6 / 31645 FlyBaseID:FBgn0027107 Length:481 Species:Drosophila melanogaster
Sequence 2:NP_788872.1 Gene:Inx7 / 33027 FlyBaseID:FBgn0027106 Length:438 Species:Drosophila melanogaster


Alignment Length:467 Identity:115/467 - (24%)
Similarity:192/467 - (41%) Gaps:106/467 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 YLRLKTVRIY--DPIFTLHSKCTIVILLTCTFLLSAKQYFGEPILCLSSERQADYVQSYCWTMGT 73
            ||:....|:.  :.:|.||.:.|.||||..|.|::::||.||.|.|||....:..:.::|:    
  Fly    11 YLKFDLTRVVIDNIVFKLHYRWTFVILLVATLLITSRQYIGEHIQCLSDGVVSPVINTFCF---- 71

  Fly    74 YILPAEVDRDGGSSWEYALYAPTSTAAETFNVSSLRALVAQNEQYARFISIAEGVG---PETRGV 135
                               :.||.|....           ||:...|..|...|:|   ||...:
  Fly    72 -------------------FTPTFTVVRD-----------QNQTAYRPGSEPPGIGAFDPEKDTI 106

  Fly   136 TKRMYLRYYQWVFMILLFQSLLFYFPSFLWKVWEGQRMEQLCCEVGDALIVEATYRTRLQMLTRY 200
            .:.   .|||||..:|.||:|.||.|..|||.|||.|::.|            .:..|:..||||
  Fly   107 KRH---AYYQWVPFVLFFQALCFYIPHALWKSWEGGRIKAL------------VFGLRMVGLTRY 156

  Fly   201 FRAQFAPI----------------------------HWCYSIKYAFCELLNVFISILNF-WLMDV 236
            .:.....|                            :..:.....|.|:||:...:|.. |....
  Fly   157 LKNDSLRIGKLNIPSMAEAEERVKDIRRTMIDRMRLNQSWGAHLVFAEVLNLINLLLQITWTNRF 221

  Fly   237 VFNGFWYKYIHALAAIPVYDWNLWN---LMTSRVFPKVAKCEMFVYGPSGTPNIMDILCVLPLNI 298
            :...|.....|||.       |.|:   .:...||||:.||:...:|.||:..:.|.|||:.|||
  Fly   222 LGGQFLTLGPHALK-------NRWSDELSVLDLVFPKITKCKFHKFGDSGSIQMHDALCVMALNI 279

  Fly   299 LNEKIFAVLYVWFLFIALLAIMNILYRLLVIC----CPELRLQLLRTHLNGMPKSHVREVLASAG 359
            :||||:.:|:.|:.|:.::.::.:|:|:|.:|    ....|..|.......:.::.:..|:....
  Fly   280 MNEKIYIILWFWYAFLLIVTVLGLLWRILTLCFYRNVTFTRWSLYWAKPGQLDENELLAVIDKCN 344

  Fly   360 YGDWFVLMCVSINVNPTLFRELLEQLYAK---------LNQARCTEPVFAEQPCQQVPQLAQVPQ 415
            :.:|..|..:..|::..||::::..|.::         :|..|...|..|:....::..|..:..
  Fly   345 FSNWMFLFFLRSNLSEFLFKKVIYHLASEFPNPDHDNDVNAYREAPPTPAKNRYPELSGLDTIDS 409

  Fly   416 LFSHAKLDRCPS 427
            ...|.:.:..||
  Fly   410 PLLHLRRNGSPS 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Inx6NP_572374.1 Innexin 21..389 CDD:279248 104/415 (25%)
Inx7NP_788872.1 Innexin 22..374 CDD:279248 104/407 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 133 1.000 Domainoid score I3133
eggNOG 1 0.900 - - E1_2BWHM
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I3152
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D323554at33208
OrthoFinder 1 1.000 - - FOG0003274
OrthoInspector 1 1.000 - - mtm4755
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11893
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X282
98.970

Return to query results.
Submit another query.