DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Inx6 and zpg

DIOPT Version :9

Sequence 1:NP_572374.1 Gene:Inx6 / 31645 FlyBaseID:FBgn0027107 Length:481 Species:Drosophila melanogaster
Sequence 2:NP_001261478.1 Gene:zpg / 251414 FlyBaseID:FBgn0024177 Length:367 Species:Drosophila melanogaster


Alignment Length:386 Identity:183/386 - (47%)
Similarity:248/386 - (64%) Gaps:34/386 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYAAVKPLSNYLRLKTVRIYDPIFTLHSKCTIVILLTCTFLLSAKQYFGEPILCLSSERQADYVQ 65
            |||||||||.||:.|:|.|||.|||||||.|:.:||.||||||:|||||:||.|. .::..|||.
  Fly     1 MYAAVKPLSKYLQFKSVHIYDAIFTLHSKVTVALLLACTFLLSSKQYFGDPIQCF-GDKDMDYVH 64

  Fly    66 SYCWTMGTYILPAEVDRDGGSSWEYALYAPTSTAAETFNVSSLRALVAQNEQYARFISIAEGVGP 130
            ::||..|.|:                        ::...|:.||...||    .|..::::.|.|
  Fly    65 AFCWIYGAYV------------------------SDNVTVTPLRNGAAQ----CRPDAVSKVVPP 101

  Fly   131 ETRGVTKRMYLRYYQWVFMILLFQSLLFYFPSFLWKVWEGQRMEQLCCEVGDALIVEATYRTRLQ 195
            |.|.     |:.|||||.::||.:|.:||.|:||||:|||.|::.||.:.....:.:...||.|:
  Fly   102 ENRN-----YITYYQWVVLVLLLESFVFYMPAFLWKIWEGGRLKHLCDDFHKMAVCKDKSRTHLR 161

  Fly   196 MLTRYFRAQFAPIHWCYSIKYAFCELLNVFISILNFWLMDVVFNGFWYKYIHALAAIPVYDWNLW 260
            :|..||.:.:...|:.|.:.|.|||:||:.||||||.|:||.|.|||.:|.:||.::...|:|.|
  Fly   162 VLVNYFSSDYKETHFRYFVSYVFCEILNLSISILNFLLLDVFFGGFWGRYRNALLSLYNGDYNQW 226

  Fly   261 NLMTSRVFPKVAKCEMFVYGPSGTPNIMDILCVLPLNILNEKIFAVLYVWFLFIALLAIMNILYR 325
            |::|..||||.|||||:..||||:.||.|.||:||||||||||||.|::||:.:|:|..:..|||
  Fly   227 NIITMAVFPKCAKCEMYKGGPSGSSNIYDYLCLLPLNILNEKIFAFLWIWFILVAMLISLKFLYR 291

  Fly   326 LLVICCPELRLQLLRTHLNGMPKSHVREVLASAGYGDWFVLMCVSINVNPTLFRELLEQLY 386
            |..:..|.:||||||.....|||.|::..|.:..:|||||||.|..|::|.|||:|||:||
  Fly   292 LATVLYPGMRLQLLRARARFMPKKHLQVALRNCSFGDWFVLMRVGNNISPELFRKLLEELY 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Inx6NP_572374.1 Innexin 21..389 CDD:279248 168/366 (46%)
zpgNP_001261478.1 Innexin 21..353 CDD:279248 168/366 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443963
Domainoid 1 1.000 253 1.000 Domainoid score I4750
eggNOG 1 0.900 - - E1_2BWHM
Homologene 1 1.000 - - H80574
Inparanoid 1 1.050 267 1.000 Inparanoid score I5430
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26586
OrthoDB 1 1.010 - - D323554at33208
OrthoFinder 1 1.000 - - FOG0003274
OrthoInspector 1 1.000 - - mtm4755
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11893
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X282
1211.910

Return to query results.
Submit another query.