DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Inx6 and inx-5

DIOPT Version :9

Sequence 1:NP_572374.1 Gene:Inx6 / 31645 FlyBaseID:FBgn0027107 Length:481 Species:Drosophila melanogaster
Sequence 2:NP_509403.2 Gene:inx-5 / 181086 WormBaseID:WBGene00002127 Length:447 Species:Caenorhabditis elegans


Alignment Length:444 Identity:90/444 - (20%)
Similarity:161/444 - (36%) Gaps:132/444 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 TIVILLTCTFLLSAKQYFGEPILC----LSSERQADYVQSYCWTMGTYILPAEVDRDGGSSWEYA 91
            |..:|.....:::|.||.|.||.|    ..:.....|.::||:..|||.||.....:|    |.:
 Worm    30 TSTLLGFSAIMMAASQYVGRPIQCWVPAQFTRTWEKYAETYCFIKGTYFLPGAFASEG----EMS 90

  Fly    92 LYAPTSTAAETFNVSSLRALVAQNEQYARFISIAEGVGPETRGVTKRMYLRYYQWVFMILLFQSL 156
            :.:|......|..|.                                    ||||:.::|:.|:.
 Worm    91 VTSPDDAVTATPQVG------------------------------------YYQWIPIVLVLQAF 119

  Fly   157 LFYFPSFLWKVWEGQ---RMEQLCCEVGDALIVEATYRTRLQM---------LTRYF-------- 201
            |||.||.:|:.:...   ::::|      |.:.||:.:.:..|         ..|||        
 Worm   120 LFYLPSIIWRTFNESCELKIKEL------AAVSEASRKIKSNMSDDQVKATKFGRYFFKKLNFRN 178

  Fly   202 -------------RAQFAPIHWCYSIKYAFCELLNVFISILNFWLMDVVFN------GFWYKYIH 247
                         ..:|.|      ..|...::|.:...:|.||::.....      | |..:..
 Worm   179 ESPVFKETGSVVASGKFLP------ALYLLVKILYLANIVLQFWILTYFLETKSWMWG-WQTFQD 236

  Fly   248 ALAAIPVYDWNLWNLMTSRVFPKVAKCEMFVYGPSGTPNIMD--------ILCVLPLNILNEKIF 304
            .:|.   .:|.     |:.:||:|..|:.         :|||        |.||:.:|:|.||::
 Worm   237 LMAG---REWE-----TTGIFPRVTMCDF---------SIMDLTSVHDHSIQCVIVINMLAEKVY 284

  Fly   305 AVLYVWFLFIALLAIMNILYRLLVICCPELRLQLLRTHLNGMPKSHVREVLAS---AGYGD---- 362
            ...:.|.||:.||.:.::.|..::.....:....:.::|...|:....:...|   |.:.|    
 Worm   285 VFFWFWLLFVGLLTVCSLAYWAVIYMLQSVGRNFIYSYLQQTPEFQTEQERGSFVPANFVDKCLT 349

  Fly   363 ---WFVLMCVSINVNPTLFRELLEQLYAKLNQARCTEPVFAEQPCQQVPQLAQV 413
               .|:...|..|........:|.:::: |.:||..|....:.....:|..|.|
 Worm   350 PDGVFISRLVQQNSGDLFTSIMLGEMFS-LYRAREAEKAHKKDDDSALPASAPV 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Inx6NP_572374.1 Innexin 21..389 CDD:279248 83/418 (20%)
inx-5NP_509403.2 Innexin 20..379 CDD:279248 83/419 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 133 1.000 Domainoid score I3133
eggNOG 1 0.900 - - E1_2BWHM
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I3152
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D323554at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm4755
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11893
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X282
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.