DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bou and CG6329

DIOPT Version :9

Sequence 1:NP_572373.1 Gene:bou / 31644 FlyBaseID:FBgn0261284 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_001286393.1 Gene:CG6329 / 36529 FlyBaseID:FBgn0033872 Length:155 Species:Drosophila melanogaster


Alignment Length:152 Identity:41/152 - (26%)
Similarity:62/152 - (40%) Gaps:27/152 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SLALVVLLMSLQMVMVSGIECYVCDTSDTEHPFQCGEWFERYDIPDIQPQNCSSVHGAQ------ 72
            :|.|:.:|..:|  :.:.:.||.|   ::|...:||:.||.|.|.::   |||.....:      
  Fly     8 TLLLLGVLCCIQ--VTTALMCYDC---NSEFDPRCGDPFEPYSIGEV---NCSKQEPLEHLKDKY 64

  Fly    73 ---FCVKHVGRFEGGIGAKRFCS---SKDMGNYCDYVRNKGDRMDYRSCIYTCDTDGCNAAGRLE 131
               .|.|.|.:..|.....|.|.   .::..|.|  ||..|.. |..:...:|..|.||.|....
  Fly    65 KPTLCRKTVQKIYGKTRIVRGCGYIPDENTDNKC--VRRSGTH-DVAAIYCSCTKDLCNGANSPA 126

  Fly   132 LEWG----VAAALLTLTWLLRH 149
            .:|.    :.||.|.|....||
  Fly   127 GQWMMLPLIVAAGLALLLNSRH 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bouNP_572373.1 None
CG6329NP_001286393.1 QVR 24..120 CDD:407231 27/104 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR33562
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.