DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bou and CG14274

DIOPT Version :9

Sequence 1:NP_572373.1 Gene:bou / 31644 FlyBaseID:FBgn0261284 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_609212.2 Gene:CG14274 / 34145 FlyBaseID:FBgn0032023 Length:187 Species:Drosophila melanogaster


Alignment Length:193 Identity:39/193 - (20%)
Similarity:60/193 - (31%) Gaps:71/193 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GWLSSLALVVLLMSLQMVMVSGIECYVCDTSDTEHPFQCGEWFERYDIPDIQPQNCS-----SVH 69
            |.|..|||:.|:.:     .:.|.|||||:||..   .|.:....   ..|..:.|:     |:.
  Fly     3 GILLPLALLALVSN-----GAAIRCYVCDSSDNP---SCADLGSN---SSIVAEECTLDKMKSLD 56

  Fly    70 GAQFCVKHVGRFEGG-----------IGAK----------RFCSSKDMG--NYCDYVRNK----- 106
            ...|.:.....|:.|           :.||          ||| ..|.|  :.|:.:|.|     
  Fly    57 TWLFDLNKFSYFDNGANKSPLMNCQKVVAKDPDTRKVVTARFC-QLDTGDSDACEILRTKLRIPS 120

  Fly   107 ------------------------GDRMDYRSCIY--TCDTDGCNAAGRLELEWGVAAALLTL 143
                                    .|.:......:  .|.:..||.|..:.|......|::.|
  Fly   121 PEEREQRNRNQNKRRKGHGQDAEEDDEISAEDAFFCGICKSHRCNGAAAVTLSLATILAMIAL 183



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR33562
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.