DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4586 and Mcad

DIOPT Version :9

Sequence 1:NP_572371.1 Gene:CG4586 / 31641 FlyBaseID:FBgn0029924 Length:677 Species:Drosophila melanogaster
Sequence 2:NP_648149.1 Gene:Mcad / 38864 FlyBaseID:FBgn0035811 Length:419 Species:Drosophila melanogaster


Alignment Length:340 Identity:81/340 - (23%)
Similarity:130/340 - (38%) Gaps:68/340 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 TTLLSQGTEEQQAQWLNRSWHMDGVLGTYAQTELGHGTFVRGLETRADYDPITQEFILNTPTQSS 190
            |.::..|.:||:.::|.|... :.::..|..||.|.|:.|.|::|||:..  ..|:::|     .
  Fly   127 TPVILSGNKEQKKKYLGRLLE-EPLVAAYCVTEPGAGSDVSGIKTRAEKK--GDEWVIN-----G 183

  Fly   191 YKWWPGGLGNTANVAIVLAQLYVKGK---HYGLQSFVVRIRDERTHEPLTGVDVGDIGPRLGGNG 252
            .|.|... |..||...|||:.....|   ......|:|. ||.      .|:..|.....:|...
  Fly   184 QKMWITN-GGVANWYFVLARTNPDPKCPPSKAFTGFIVE-RDS------PGLTPGRKELNMGQRA 240

  Fly   253 VNNGFLGLRDVRIPRNQMLMKNAQ--VLTDGTFVQGRPPLLLYGTMVYVRVITVKDVLFGLLQ-A 314
            .:...:...|||:|:..:|:....  .:..|||.:.|||:.. |.:             ||.| .
  Fly   241 SDTRGITFEDVRVPKENVLIGEGAGFKIAMGTFDKTRPPVAA-GAV-------------GLAQRC 291

  Fly   315 ATIATRYSVVRRQSRINSDQPEVSVLDHITQQAKILPQIARGV-----SYRLVSDWLWRFYEDVL 374
            ...|.:|::.|:..       .|.:..|...|. :|..:|.||     ::|| |.|         
  Fly   292 LDEALKYALERKTF-------GVPIAYHQAVQF-MLADMAIGVETSRLAWRL-SAW--------- 338

  Fly   375 RQLEDESTKGRNSLPELHALSCCLKAVATDEASEGVDLLRKSCGGHGFLSSANFDSIYGLTAATY 439
                 |..:||.:........|....:|...||:.|.:.    ||:||.|....:.:........
  Fly   339 -----EIDQGRRNSYYASIAKCHAADMANKIASDAVQIF----GGNGFNSEYPVEKLMRDAKIYQ 394

  Fly   440 TYEGEYTVLLLQTAR 454
            .|||...:..|..:|
  Fly   395 IYEGTSQIQRLIISR 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4586NP_572371.1 ACAD 6..653 CDD:299127 81/340 (24%)
PLN02443 7..677 CDD:178062 81/340 (24%)
McadNP_648149.1 CaiA 35..411 CDD:224871 81/340 (24%)
MCAD 37..414 CDD:173846 81/340 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460789
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.