DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4586 and Egm

DIOPT Version :9

Sequence 1:NP_572371.1 Gene:CG4586 / 31641 FlyBaseID:FBgn0029924 Length:677 Species:Drosophila melanogaster
Sequence 2:NP_610687.1 Gene:Egm / 36242 FlyBaseID:FBgn0086712 Length:639 Species:Drosophila melanogaster


Alignment Length:377 Identity:91/377 - (24%)
Similarity:149/377 - (39%) Gaps:80/377 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   315 ATIATRYSV-VRRQSRINSDQPEVSVLDHITQQAKILP---QIARGVSYRLVSDWLWRFYEDVLR 375
            :|.||..|: .:.|....::......::...:|.:.||   .:|:.....:|...|..:.|.:.|
  Fly    27 STKATSSSLDSQHQDAATTEGGRAESVEESPEQQRKLPTREPLAKNFFIGVVDKELLAYPEVIPR 91

  Fly   376 QLEDESTKGRNSLPELHALSCCLKAVATDEASEGVDLLRKSCGGHGFLSSANFDSI-YGLTAATY 439
               ||..:..|||  |...:..::...|:|.|.  :.||: .|.:|...|.:::.. ||.:|:..
  Fly    92 ---DEMAQLENSL--LPLKNYFVEPRETEETSP--ETLRQ-LGLYGLNVSTDYEGKGYGWSASLM 148

  Fly   440 TYEGEYT----VLLLQTARFLVRQYADSLKRKVLP-SSVSYLRDTARLIWGKNLVANCVRALEIS 499
            ..|.:.|    .|.|||.|.:|    |.||....| ....||:|.|.   ||.:....:  .|||
  Fly   149 ASEPDSTDINVTLGLQTHRVVV----DLLKEVGTPLQQQRYLQDLAT---GKLIGTEAI--YEIS 204

  Fly   500 AMEQVRDAWQTQKMHQSGKVSPEMAS-NLAGRQLTSAAIAHAHAFFTRNALEQVEALRKKGDLSP 563
            ..|:  |.:.|     :.::.||... .|.|.:............|.  .|.|.:        .|
  Fly   205 PPEE--DYFNT-----TAELFPEYGKWQLNGEKSFVICTPGERQLFL--VLAQTQ--------QP 252

  Fly   564 NVSLILGQLVELFVIDTFLRQSGCVLRWNNGITGTQLRFVER-RFEELLAKLRPNAVALVDGFDF 627
            ||..:||:...:|::|:  :|.|..|...:...|.:...:.| .||.:  ||.            
  Fly   253 NVPGVLGRGTTIFLVDS--QQEGVRLGEKHATFGCRKAEIRRVHFEGV--KLG------------ 301

  Fly   628 HDRVLGSTLGCHDGRVY-ERLMEEAR--------------RNPINQEPVNSS 664
            .|:|:|..   |||..| |:|:..:|              .|.:.|..||::
  Fly   302 EDQVVGLP---HDGNRYSEQLVRSSRLRGSLVGLSLAKKLLNELAQYTVNTT 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4586NP_572371.1 ACAD 6..653 CDD:299127 87/364 (24%)
PLN02443 7..677 CDD:178062 91/377 (24%)
EgmNP_610687.1 ACAD 92..457 CDD:173838 78/309 (25%)
CaiA 122..439 CDD:224871 69/275 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.