DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4586 and ACADSB

DIOPT Version :9

Sequence 1:NP_572371.1 Gene:CG4586 / 31641 FlyBaseID:FBgn0029924 Length:677 Species:Drosophila melanogaster
Sequence 2:NP_001600.1 Gene:ACADSB / 36 HGNCID:91 Length:432 Species:Homo sapiens


Alignment Length:345 Identity:72/345 - (20%)
Similarity:132/345 - (38%) Gaps:62/345 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 SMFMTTLLSQGTEEQQAQWLNRSWHMDGVLGTYAQTELGHGTFVRGLETRADYDPITQEFILNTP 186
            ::..|.:...|||||:|.:|.:.  ....:|::..:|.|.|:....|:||||.:  ...::||  
Human   144 TLINTLIRKHGTEEQKATYLPQL--TTEKVGSFCLSEAGAGSDSFALKTRADKE--GDYYVLN-- 202

  Fly   187 TQSSYKWWPGGLGNTANVAIVLAQLYVKGKHYGLQSFVVRIRDERTHEPLTGVDVGDIGPRLGGN 251
               ..|.|... ...|.:.:|:|.:.....:.|:.||:|   |..|    .|:.:|....:||..
Human   203 ---GSKMWISS-AEHAGLFLVMANVDPTIGYKGITSFLV---DRDT----PGLHIGKPENKLGLR 256

  Fly   252 GVNNGFLGLRDVRIPRNQML--MKNAQVLTDGTFVQGRPPLLLYGTMVYVRVITVKDVLFGLLQA 314
            ..:...|...:|::|...:|  :.:......|:..:||              |.:...:.||.|.
Human   257 ASSTCPLTFENVKVPEANILGQIGHGYKYAIGSLNEGR--------------IGIAAQMLGLAQG 307

  Fly   315 ATIATRYSVVRRQSRINSDQP--EVSVLDHITQQAKILPQI--ARGVSYRLVSDWLWRFYEDVLR 375
               ...|::...:.||...:.  :...|.|  |.|.:..|:  ||.::|            :..|
Human   308 ---CFDYTIPYIKERIQFGKRLFDFQGLQH--QVAHVATQLEAARLLTY------------NAAR 355

  Fly   376 QLEDESTKGRNSLPELHALSCCLKAVATDEASEGVDLLRKSCGGHGFLSSANFDSIYGLTAATYT 440
            .||    .|:..:.|..........:|....|:.::.:    ||.|:......:..:........
Human   356 LLE----AGKPFIKEASMAKYYASEIAGQTTSKCIEWM----GGVGYTKDYPVEKYFRDAKIGTI 412

  Fly   441 YEGEYTVLLLQTARFLVRQY 460
            |||...:.|...|:.:..:|
Human   413 YEGASNIQLNTIAKHIDAEY 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4586NP_572371.1 ACAD 6..653 CDD:299127 72/345 (21%)
PLN02443 7..677 CDD:178062 72/345 (21%)
ACADSBNP_001600.1 CaiA 57..428 CDD:224871 71/339 (21%)
SCAD_SBCAD 59..430 CDD:173847 71/341 (21%)
Substrate binding. /evidence=ECO:0000269|Ref.15 291..294 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.