DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4586 and ACADM

DIOPT Version :9

Sequence 1:NP_572371.1 Gene:CG4586 / 31641 FlyBaseID:FBgn0029924 Length:677 Species:Drosophila melanogaster
Sequence 2:NP_001272972.1 Gene:ACADM / 34 HGNCID:89 Length:454 Species:Homo sapiens


Alignment Length:471 Identity:105/471 - (22%)
Similarity:179/471 - (38%) Gaps:103/471 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 QLEERRALERRFYEDPDFAEPVHPSCLSYKERYEQTVARSTRFLAKLRQWQREKQ---------- 85
            |.:|.:|..|:|..     |.:.|....|.:..|..|.     |.: |.|:....          
Human    44 QQKEFQATARKFAR-----EEIIPVAAEYDKTGEYPVP-----LIR-RAWELGLMNTHIPENCDY 97

  Fly    86 ---PQLQLSVNMLRDFRLLLSGS----------LGTGLFQQ---SFPLRVHFSMFMTTL----LS 130
               |.|:.....|..|.|||:||          ||.|.|..   |..|....:...|.:    |.
Human    98 SVCPLLEACTLYLDAFFLLLTGSNLNLHLNLGGLGLGTFDACLISEELAYGCTGVQTAIEGNSLG 162

  Fly   131 Q------GTEEQQAQWLNRSWHMDGVLGTYAQTELGHGTFVRGLETRADYDPITQEFILNTPTQS 189
            |      |.::|:.::|.|... :.::..|..||.|.|:.|.|::|:|:..  ..|:|:|     
Human   163 QMPIIIAGNDQQKKKYLGRMTE-EPLMCAYCVTEPGAGSDVAGIKTKAEKK--GDEYIIN----- 219

  Fly   190 SYKWWPGGLGNTANVAIVLAQLYVKGKHYGLQSFVVRIRDERTHEPLTGVDVGDIGPRLGGNGVN 254
            ..|.|... |..||...:||:.....|....::|...|.:..|    .|:.:|.....:|....:
Human   220 GQKMWITN-GGKANWYFLLARSDPDPKAPANKAFTGFIVEADT----PGIQIGRKELNMGQRCSD 279

  Fly   255 NGFLGLRDVRIPRNQMLMKNAQ--VLTDGTFVQGRPPLLLYGTMVYVRVITVKDVLFGLLQ-AAT 316
            ...:...||::|:..:|:.:..  .:..|.|.:.||            |:....|  ||.| |..
Human   280 TRGIVFEDVKVPKENVLIGDGAGFKVAMGAFDKTRP------------VVAAGAV--GLAQRALD 330

  Fly   317 IATRYSVVRRQ-SRINSDQPEVSVLDHITQQA-KILPQIARGVSYRLVSDWLWRFYEDVLRQLED 379
            .||:|::.|:. .::..:...:|.:  :.:.| |:  ::|| :||:..:   |            
Human   331 EATKYALERKTFGKLLVEHQAISFM--LAEMAMKV--ELAR-MSYQRAA---W------------ 375

  Fly   380 ESTKGRNSLPELHALSCCLKAVATDEASEGVDLLRKSCGGHGFLSSANFDSIYGLTAATYTYEGE 444
            |...||.:.............:|...|::.|.:|    ||:||.:....:.:.........|||.
Human   376 EVDSGRRNTYYASIAKAFAGDIANQLATDAVQIL----GGNGFNTEYPVEKLMRDAKIYQIYEGT 436

  Fly   445 YTVLLLQTARFLVRQY 460
            ..:..|..||..:.:|
Human   437 SQIQRLIVAREHIDKY 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4586NP_572371.1 ACAD 6..653 CDD:299127 105/471 (22%)
PLN02443 7..677 CDD:178062 105/471 (22%)
ACADMNP_001272972.1 CaiA 39..453 CDD:224871 105/471 (22%)
MCAD 41..451 CDD:173846 104/468 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.