DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4586 and ACAD8

DIOPT Version :9

Sequence 1:NP_572371.1 Gene:CG4586 / 31641 FlyBaseID:FBgn0029924 Length:677 Species:Drosophila melanogaster
Sequence 2:XP_024304205.1 Gene:ACAD8 / 27034 HGNCID:87 Length:493 Species:Homo sapiens


Alignment Length:333 Identity:69/333 - (20%)
Similarity:114/333 - (34%) Gaps:72/333 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 SLGTGLFQQSFPLRVHFSMFMTTLLSQGTEEQQAQWLNRSWHMDGVLGTYAQTELGHGTFVRGLE 169
            :|.||....:..:.:| :|....:.|.|.|||:.::......|: ...:|..||.|.|:....|.
Human   111 ALATGCTSTTAYISIH-NMCAWMIDSFGNEEQRHKFCPPLCTME-KFASYCLTEPGSGSDAASLL 173

  Fly   170 TRADYDPITQEFILNTPTQSSYKWWPGGLGNTANVAIVLAQLYVKGKHYGLQSFVVRIRDERTHE 234
            |.|...  ...:|||     ..|.:..|.|. :::.:|:.:....|.. |:...||       .:
Human   174 TSAKKQ--GDHYILN-----GSKAFISGAGE-SDIYVVMCRTGGPGPK-GISCIVV-------EK 222

  Fly   235 PLTGVDVGDIGPRLGGNGVNNGFLGLRDVRIPRNQMLMKNAQVLTDGTFVQGRPPLLLYGTMVYV 299
            ...|:..|....::|.|......:...|..:|....:....|                 |.::.|
Human   223 GTPGLSFGKKEKKVGWNSQPTRAVIFEDCAVPVANRIGSEGQ-----------------GFLIAV 270

  Fly   300 R-----VITVKDVLFGLLQAATIATRYSVVRRQSRINSDQPEVSVLDHITQQAKILPQIARG--- 356
            |     .|.:.....|...|:.|.||                    ||:..:.:....:|..   
Human   271 RGLNGGRINIASCSLGAAHASVILTR--------------------DHLNVRKQFGEPLASNQYL 315

  Fly   357 ------VSYRLVSDWLWRFYEDVLRQLEDESTKGRNSLPELHALSCCLKAVATDEASEGVDLLRK 415
                  ::.|||:..|......|..|.|.:......|:.:|.|...|. ||:....|.|:|  |:
Human   316 QFTLADMATRLVAARLMVRNAAVALQEERKDAVALCSMAKLFATDECF-AVSDSSGSPGMD--RE 377

  Fly   416 SCGGHGFL 423
            ...|.|.|
Human   378 QLLGPGVL 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4586NP_572371.1 ACAD 6..653 CDD:299127 69/333 (21%)
PLN02443 7..677 CDD:178062 69/333 (21%)
ACAD8XP_024304205.1 IBD 41..387 CDD:173851 69/333 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.