DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Setd3 and RKM1

DIOPT Version :9

Sequence 1:NP_727144.1 Gene:Setd3 / 31638 FlyBaseID:FBgn0052732 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_015116.1 Gene:RKM1 / 855893 SGDID:S000006129 Length:583 Species:Saccharomyces cerevisiae


Alignment Length:310 Identity:55/310 - (17%)
Similarity:98/310 - (31%) Gaps:117/310 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 DELVLSVPRKLILSEENNSDCRLFGKMTQATHLN----LAY---------DLVIEKIRGEFSEWR 207
            |...:.:|.::::|  .|...:.||......::|    |.:         |.:::.:|.. .:::
Yeast    43 DNPSIKIPPEIVIS--RNLPMKFFGLSESTKNINGWLKLFFAKIKFDRDNDTIVDNVRVN-DKFK 104

  Fly   208 PYIDVLPAKYNTVLYFTTKQMELLRGTAAAALAMRQCRVIAKQYAFLYKYAHTMTEPSTGNRSHP 272
            ||:|.||::.|:.|.:...:::.|..|                              :.||..|.
Yeast   105 PYLDALPSRLNSPLVWNPSELKRLSST------------------------------NIGNSIHE 139

  Fly   273 GERGLF------------------------------FTQHGLCYKLYR---------WAVSTVMT 298
            ...|:|                              .|...|..|:.:         |.......
Yeast   140 KFEGIFKEWFELVSSSDMFDLERVADDVQTFHNLDELTYEALYEKILKITELQRPTIWYSFPAFL 204

  Fly   299 RQNLVPSEKQESE-----DGPKLISALIPYWDMANHRPGKITSFY-------------ATVSRQL 345
            ..:|:...:...|     :.|.....|:|..|:.||.......:|             |:.||:|
Yeast   205 WSHLIFISRAFPEYVLNRNCPDNSIVLLPIVDLLNHDYRSKVKWYPENGWFCYEKIGTASQSREL 269

  Fly   346 ECTAQEAVNTGEQFFIYYGDRSNTDLLVHNGFVDPNNTKDYVNIRVGLSL 395
            ...              ||.:.|.:||...|||..:|..|.|.::|.|.|
Yeast   270 SNN--------------YGGKGNEELLSGYGFVLEDNIFDSVALKVKLPL 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Setd3NP_727144.1 SET_SETD3 119..378 CDD:380953 47/291 (16%)
Rubis-subs-bind 400..524 CDD:370401
RKM1NP_015116.1 SET 10..288 CDD:394802 47/291 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345880
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1337
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001685
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101154
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1321
SonicParanoid 1 1.000 - - X3007
TreeFam 00.000 Not matched by this tool.
76.670

Return to query results.
Submit another query.