DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Setd3 and RKM3

DIOPT Version :9

Sequence 1:NP_727144.1 Gene:Setd3 / 31638 FlyBaseID:FBgn0052732 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_009586.1 Gene:RKM3 / 852318 SGDID:S000000234 Length:552 Species:Saccharomyces cerevisiae


Alignment Length:396 Identity:75/396 - (18%)
Similarity:116/396 - (29%) Gaps:158/396 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 DDQTRLAKVEAFSAWAKDGGVHSEGLEIAIFPGYQLGLRATRPLAKDELVLSVPRKLILSEENNS 174
            ||..|:.|..|..    :|.......:|...|...||:.|...:|:.|.:|::.:..|.|..|:|
Yeast     7 DDVHRILKFVANC----NGRFEDSKCDIRESPLGGLGVFAKTDIAEGESILTLNKSSIFSASNSS 67

  Fly   175 ------DCRLFGKMTQATHLNLAYDLVIEKIRGEFSEWRPYIDV-----------LPAKYNTVLY 222
                  |..:.|.:.    ||:|:.......|.. |.|.|::..           ||..     :
Yeast    68 IANLLCDSSIDGMLA----LNIAFIYETTVFRNS-SHWYPFLRTIRIRDDEGHLNLPPS-----F 122

  Fly   223 FTTKQMELLRGTAAAAL--AMRQCRVIAKQYAFLYKYAHTMTEPSTGNRSHPGERGLFFTQHGLC 285
            :......||:||:...|  ::.....|.:.:......||...:          |.||        
Yeast   123 WHADAKRLLKGTSFDTLFDSLAPEEEIMEGFEIAVDLAHKWND----------EFGL-------- 169

  Fly   286 YKLYRWAVSTVMTRQNLVPSEKQESEDG----PKLIS------------------ALIPYWDMAN 328
                      .:.:..|..||:...||.    .|.||                  ||:|..|:.|
Yeast   170 ----------EIPKGFLDVSEENHEEDYNLKLEKFISVAYTLSSRGFEIDAYHETALVPIADLFN 224

  Fly   329 HRPG-----------------------------------------KITSF--------------- 337
            |...                                         |:.|.               
Yeast   225 HHVSDPDLKFVSLYDVCDKCGEPDMCKHLIAEEYLEAENLDKNMPKVASMETRVIDEDLIKSLEN 289

  Fly   338 -----YATVSRQL-----------EC---TAQEAVNTGEQFFIYYGDRSNTDLLVHNGFVDPNNT 383
                 |:.|:..:           ||   ..:..|..|::.|..||:.||..||...||..|.|.
Yeast   290 DLEKEYSNVTANIEDDDGGIENPDECVDLVLKNDVAQGQEIFNSYGELSNVFLLARYGFTVPENQ 354

  Fly   384 KDYVNI 389
            .|.|::
Yeast   355 YDIVHL 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Setd3NP_727144.1 SET_SETD3 119..378 CDD:380953 66/374 (18%)
Rubis-subs-bind 400..524 CDD:370401
RKM3NP_009586.1 SET_LSMT 27..349 CDD:380925 64/359 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1337
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13271
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.