DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Setd3 and RKM4

DIOPT Version :9

Sequence 1:NP_727144.1 Gene:Setd3 / 31638 FlyBaseID:FBgn0052732 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_010543.1 Gene:RKM4 / 851844 SGDID:S000002665 Length:494 Species:Saccharomyces cerevisiae


Alignment Length:311 Identity:67/311 - (21%)
Similarity:127/311 - (40%) Gaps:63/311 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 DDQTRLAKVEAFSAWAKDGGVHSEGLEIAIFPGYQL----------GLRATRPLAKDELVLSVPR 164
            ||.:|  ..|.|..|.|...      ||.:.|..::          .:.||:.:.|||.:..:||
Yeast     2 DDFSR--DTENFVCWLKTTA------EIEVSPKIEIKDLCCDNQGRAVVATQKIKKDETLFKIPR 58

  Fly   165 KLILSEENNSDCR----LFGKMTQATH------LNLAYDLVIEKIRGEFSEWRPYIDV--LPAKY 217
            ..:||...:...:    |..|....|.      :.:.|::   ::..|.|.|.||..|  .|:..
Yeast    59 SSVLSVTTSQLIKDYPSLKDKFLNETGSWEGLIICILYEM---EVLQERSRWAPYFKVWNKPSDM 120

  Fly   218 NTVLYFTTKQMELLRGTAAAALAMRQCRVIAKQYAFLYKYAHTMTEPSTGNRSHPGERGLFFTQH 282
            |.::::...:::||:    .:|.:.:   |.|:.|   |..|.....|.  :...||    |::.
Yeast   121 NALIFWDDNELQLLK----PSLVLER---IGKKEA---KEMHERIIKSI--KQIGGE----FSRV 169

  Fly   283 GLCYKL--YRWAVSTVMT------RQNLVPSEKQESE------DGPKLISALIPYWDMANHRPGK 333
            ...::.  :.:..|.:::      .|:...:|.:|.|      :..:.:.::||..||.|....|
Yeast   170 ATSFEFDNFAYIASIILSYSFDLEMQDSSVNENEEEETSEEELENERYLKSMIPLADMLNADTSK 234

  Fly   334 ITSFYATVSRQLECTAQEAVNTGEQFFIYYGDRSNTDLLVHNGFVDPNNTK 384
            ..:.....|..|:..|...:...||.:..||:..|::||...|:|:.:.:|
Yeast   235 CNANLTYDSNCLKMVALRDIEKNEQVYNIYGEHPNSELLRRYGYVEWDGSK 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Setd3NP_727144.1 SET_SETD3 119..378 CDD:380953 62/294 (21%)
Rubis-subs-bind 400..524 CDD:370401
RKM4NP_010543.1 SET_SETD6 21..281 CDD:380955 58/278 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13271
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1321
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.