DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Setd3 and AT5G14260

DIOPT Version :9

Sequence 1:NP_727144.1 Gene:Setd3 / 31638 FlyBaseID:FBgn0052732 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_196930.2 Gene:AT5G14260 / 831276 AraportID:AT5G14260 Length:514 Species:Arabidopsis thaliana


Alignment Length:416 Identity:86/416 - (20%)
Similarity:153/416 - (36%) Gaps:126/416 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 QAVCPQISD------SPDDQTRLAKVEAFSAWAKDGGVHSEGLEIAI----FPGYQLGLR----- 148
            :::|...||      ||.:..|.:||.     :|..|..||.|:..:    .|..::.|:     
plant    46 RSLCVSSSDTLVASGSPKEDERQSKVS-----SKKEGDDSEDLKFWMDKNGLPPCKVILKERPAH 105

  Fly   149 -----------ATRPLAKDELVLSVPRKLILSEENNSDCRLFGKMTQATHLN---------LAYD 193
                       |:..|.|.::..|||..|:::.|     |:.|..|.|..|.         ||..
plant   106 DQKHKPIHYVAASEDLQKGDVAFSVPDSLVVTLE-----RVLGNETIAELLTTNKLSELACLALY 165

  Fly   194 LVIEKIRGEFSEWRPYIDVLPAK-------YNTVLYFTTKQMELLRGTAAAALAMRQCRVIAKQY 251
            |:.||.:|:.|.|.|||..|..:       ..:.|.::..:::.|.|:...|..:.:...|.::|
plant   166 LMYEKKQGKKSVWYPYIRELDRQRGRGQLDAESPLLWSEAELDYLTGSPTKAEVLERAEGIKREY 230

  Fly   252 A------FLYKYAHTMTEPSTGNRSHPGERGLFFTQH-------GLCYKLYRWAV----STVMTR 299
            .      |:                    .|..|.|:       ...:::::.|.    |.|:..
plant   231 NELDTVWFM--------------------AGSLFQQYPFDIPTEAFSFEIFKQAFVAIQSCVVHL 275

  Fly   300 QN--------LVPSEKQESEDGPKLISALIPYWDMANHRPGKITSFYATVSRQLECTAQEAVNTG 356
            ||        |||.       ||.|::..           ....:....|...:|.........|
plant   276 QNVGLARRFALVPL-------GPPLLAYC-----------SNCKAMLTAVDGAVELVVDRPYKAG 322

  Fly   357 EQFFIYYGDRSNTDLLVHNGFVDPNNTKDYVNIRVGLSLTD------ALAAKRASILDKLNIRHT 415
            :...::.|.:.|..||::.||||.:|..|.|.:...|:..|      .:.|:|...|.    :..
plant   323 DPIVVWCGPQPNAKLLLNYGFVDEDNPYDRVIVEAALNTEDPQYQDKRMVAQRNGKLS----QQV 383

  Fly   416 AELRVLPAPDFISKELLAFVRVFKMS 441
            .::||....:.: :::|.::|:..||
plant   384 FQVRVGKEREAV-QDMLPYLRLGYMS 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Setd3NP_727144.1 SET_SETD3 119..378 CDD:380953 61/319 (19%)
Rubis-subs-bind 400..524 CDD:370401 9/42 (21%)
AT5G14260NP_196930.2 Rubis-subs-bind 369..483 CDD:286371 9/45 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1337
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I2455
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D489371at2759
OrthoFinder 1 1.000 - - FOG0001685
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13271
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.930

Return to query results.
Submit another query.