DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Setd3 and AT3G55080

DIOPT Version :9

Sequence 1:NP_727144.1 Gene:Setd3 / 31638 FlyBaseID:FBgn0052732 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_191068.2 Gene:AT3G55080 / 824674 AraportID:AT3G55080 Length:463 Species:Arabidopsis thaliana


Alignment Length:415 Identity:102/415 - (24%)
Similarity:164/415 - (39%) Gaps:69/415 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 YQLGLRATRPLAKDELVLSVP-RKLILSEENNSDCRLFGKMTQATHLNLAYDLVIEKIRGEFSEW 206
            |...|.|::.:...:.:|.|| ...|..:|..||.|:...........||..|:.||..|:.|.|
plant    69 YGRSLFASKVIYAGDCMLKVPFNAQITPDELPSDIRVLLSNEVGNIGMLAAVLIREKKMGQKSRW 133

  Fly   207 RPYIDVL--PAKYNTVLYFTTKQMELLRGTAAAALAMRQCRVIAKQYAFLYKYAHTMTEPSTGNR 269
            .|||..|  ||:.::.:::...::.::|.:|.....::|...|.|.::|:.:             
plant   134 VPYISRLPQPAEMHSSIFWGEDELSMIRCSAVHQETVKQKAQIEKDFSFVAQ------------- 185

  Fly   270 SHPGERGLFFTQHGLC-YKLYRWAVSTVMTRQNLVPSEKQESEDGPKLISALIPYWDMANHRPGK 333
                    .|.||  | ....|..:...|....||.|...|:.   |.|| |||:.|..||....
plant   186 --------AFKQH--CPIVTERPDLEDFMYAYALVGSRAWENS---KRIS-LIPFADFMNHDGLS 236

  Fly   334 ITSFYATVSRQL-ECTAQEAVNTGEQFFIYYGDRSNTDLLVHNGFVDPNNTKDYVNIRVGLSLTD 397
            .:........|| |.||....:.|::.||.||:.||..|::..||..|.|..|.|.|::.:...|
plant   237 ASIVLRDEDNQLSEVTADRNYSPGDEVFIKYGEFSNATLMLDFGFTFPYNIHDEVQIQMDVPNDD 301

  Fly   398 ALAAKRASILDKLNIRHTAELRVL--PAPDFISKE--------------LLAFVRVFKMSAEQLD 446
            .|...:..:|...:.|...::.:.  ....|..||              |.||.||......|  
plant   302 PLRNMKLGLLQTHHTRTVKDINIFHSSCDTFTIKEVKSAIGKGKGIPQSLRAFARVLCCIIPQ-- 364

  Fly   447 HWCSDLDRAGDLLHIDCALETDHETRTWQFLE-----DRLKLLLAVFNK--EMHEADEVKELELK 504
             ..:||.:.        |.:.|.......|.:     :..|:||:..|:  |.|... :||:|  
plant   365 -ELNDLSKE--------AAQNDGRLARLPFKDGNRELEAHKILLSHINRLIEDHSVC-IKEME-- 417

  Fly   505 DGQEIELMLFLYRRLERSILAGALQ 529
            :...:.....:.|::.|.:|.|.|:
plant   418 ECYFVSQRFAVRRQMARDLLYGELR 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Setd3NP_727144.1 SET_SETD3 119..378 CDD:380953 64/239 (27%)
Rubis-subs-bind 400..524 CDD:370401 27/146 (18%)
AT3G55080NP_191068.2 SET_RBCMT 59..282 CDD:380956 64/239 (27%)
Rubis-subs-bind 346..444 CDD:401276 25/111 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D489371at2759
OrthoFinder 1 1.000 - - FOG0001685
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.