DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Setd3 and AT2G18850

DIOPT Version :9

Sequence 1:NP_727144.1 Gene:Setd3 / 31638 FlyBaseID:FBgn0052732 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_179475.3 Gene:AT2G18850 / 816400 AraportID:AT2G18850 Length:543 Species:Arabidopsis thaliana


Alignment Length:470 Identity:115/470 - (24%)
Similarity:172/470 - (36%) Gaps:123/470 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 DQTRLAKVEAFSAWAKDGGVHSEGLEIAIFPGYQLGLRATRPLAKDELVLSVPRKLILSEE--NN 173
            |..|..|......|.:|.||.:: |:||...||..|..|:..|...::.|.:|...|:|||  .|
plant   143 DSYRCEKESKLVEWGQDNGVKTK-LQIAQIDGYGRGAIASEDLKFGDVALEIPVSSIISEEYVYN 206

  Fly   174 SD----CRLFGKMTQATHLNLAYDLVIEKIRGEFSEWRPYIDVLPAKYNTVLYFTTKQMELLRGT 234
            ||    ...|..:|..|.|.|   ..:.:.....|:::||.|.|...:.|.|.|....:..|.||
plant   207 SDMYPILETFDGITSETMLLL---WTMREKHNLDSKFKPYFDSLQENFCTGLSFGVDAIMELDGT 268

  Fly   235 AAAALAMRQCRVIAKQYAFLYKYAHTMTEPSTGNRSHPGERGLFFTQHGLCYKLYRWAVSTVMTR 299
            ......|:...::.::|..|.        |...|........|:..:|      |.||.....:.
plant   269 LLLDEIMQAKELLRERYDELI--------PLLSNHREVFPPELYTWEH------YLWACELYYSN 319

  Fly   300 QNLVPSEKQESEDGPKLISALIPYWDMANH-------RPGKI----TSFYATVSRQLECTAQEAV 353
                 |.:.:..|| ||.:.|||.....||       :.||:    :|....|||  .|      
plant   320 -----SMQIKFPDG-KLKTCLIPVAGFLNHSIYPHIVKYGKVDIETSSLKFPVSR--PC------ 370

  Fly   354 NTGEQFFIYYGDRSNTDLLVHNGFVDPNNTKDYVNIRVGLSLTD-----------ALAAKRASIL 407
            |.|||.|:.||:.|::.||...||: |.....|..|.:...:.|           ....:...:.
plant   371 NKGEQCFLSYGNYSSSHLLTFYGFL-PKGDNPYDVIPLDFDVIDDEDIETEFSWTTHMLRGTWLS 434

  Fly   408 DKLNIRHTAELRVLPAPDFISKELLAFVRVFKMSAEQLDHWCSDLDRAGDLLHIDCALETDHETR 472
            ...||.|..    ||.|      ||.::|                 :|..|:|       ..||.
plant   435 SNHNIFHYG----LPTP------LLNYLR-----------------KAHGLVH-------HSETD 465

  Fly   473 TWQFLEDR---LKLLLAVFNKEMH---EADEVKE----------LELKDGQEIELMLFLYRRLER 521
            .|:.||..   |:.|.:.|:..|.   :||.:..          :|.|:.|         |::..
plant   466 LWKNLEVEIGVLENLQSTFDDMMQNLGDADSIDRENADWDVKLAMEFKERQ---------RKIVS 521

  Fly   522 SIL---AGALQYAQE 533
            |||   :..::..||
plant   522 SILDSCSAGIKLVQE 536

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Setd3NP_727144.1 SET_SETD3 119..378 CDD:380953 75/275 (27%)
Rubis-subs-bind 400..524 CDD:370401 28/139 (20%)
AT2G18850NP_179475.3 SET_LSMT 165..395 CDD:380925 71/261 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.