DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Setd3 and SETD6

DIOPT Version :9

Sequence 1:NP_727144.1 Gene:Setd3 / 31638 FlyBaseID:FBgn0052732 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_001153777.1 Gene:SETD6 / 79918 HGNCID:26116 Length:473 Species:Homo sapiens


Alignment Length:499 Identity:109/499 - (21%)
Similarity:200/499 - (40%) Gaps:107/499 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 SQAVCPQISDSPDDQTRLAKVEAFSAWA-------------KDGGVHSEG----------LEIAI 139
            :||..|::: .|.|...|..|..|.:|.             :.||..:.|          .::|:
Human     3 TQAKRPRVA-GPVDGGDLDPVACFLSWCRRVGLELSPKVSERAGGRRTRGGARAALTSPPAQVAV 66

  Fly   140 -----FPGYQLGLRATRPLAKDELVLSVPRKLILSEENNSDCRLFGKM--------TQATHLNLA 191
                 ..||  |:.|...:...||:..|||..:||:..   |.:.|.:        :|:..:.|.
Human    67 SRQGTVAGY--GMVARESVQAGELLFVVPRAALLSQHT---CSIGGLLERERVALQSQSGWVPLL 126

  Fly   192 YDLVIEKIRGEFSEWRPYIDVLP--AKYNTVLYFTTKQME-LLRGTAAAALAMRQCRVIAKQYAF 253
            ..| :.:::...|.||||..:.|  .:....:::..::.. ||:||.......:....|..:|  
Human   127 LAL-LHELQAPASRWRPYFALWPELGRLEHPMFWPEEERRCLLQGTGVPEAVEKDLANIRSEY-- 188

  Fly   254 LYKYAHTMTEPSTGNRSHPGERGLFFTQHGLCYKLYRWAVSTVMTRQNLVPSEKQESEDGPKLIS 318
                 .::..|..  .:||.    .|:......:||...|:.||......|.|::|.|..|. ..
Human   189 -----QSIVLPFM--EAHPD----LFSLRVRSLELYHQLVALVMAYSFQEPLEEEEDEKEPN-SP 241

  Fly   319 ALIPYWDMANHRPGKITSFYATVSRQLEC---TAQEAVNTGEQFFIYYGDRSNTDLLVHNGFVD- 379
            .::|..|:.||    :.:..|.:.....|   .|.:.:..|.:.|..||..:|..|:...|||: 
Human   242 VMVPAADILNH----LANHNANLEYSANCLRMVATQPIPKGHEIFNTYGQMANWQLIHMYGFVEP 302

  Fly   380 -PNNTKDYVNIRVGLSLTDA------------LAAKRASILDKLNIRHTAELRVLPAPDFIS-KE 430
             |:||.|..:|:: :::.:|            |..:|...|.||.:.......|:...:.:: :|
Human   303 YPDNTDDTADIQM-VTVREAALQGTKTEAERHLVYERWDFLCKLEMVGEEGAFVIGREEVLTEEE 366

  Fly   431 LLAFVRVFKMSAEQLDHWCSDLDRAGDLLHIDCALETDHETR---TW-QFLEDRLKLLLAVF--- 488
            |...::|..|.||:... ..|.|..||....:.:|...:..:   :| |.|::.:.|.|..:   
Human   367 LTTTLKVLCMPAEEFRE-LKDQDGGGDDKREEGSLTITNIPKLKASWRQLLQNSVLLTLQTYATD 430

  Fly   489 ---------NKEMHEA---DEVKELELKDGQEIELMLFLYRRLE 520
                     |||::..   .|.:.|:::.||:    :.|::.||
Human   431 LKTDQGLLSNKEVYAKLSWREQQALQVRYGQK----MILHQLLE 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Setd3NP_727144.1 SET_SETD3 119..378 CDD:380953 62/300 (21%)
Rubis-subs-bind 400..524 CDD:370401 31/141 (22%)
SETD6NP_001153777.1 SET <247..286 CDD:279228 8/42 (19%)
Rubis-subs-bind 338..465 CDD:286371 28/131 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1321
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.