DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Setd3 and setd4

DIOPT Version :9

Sequence 1:NP_727144.1 Gene:Setd3 / 31638 FlyBaseID:FBgn0052732 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_001039027.1 Gene:setd4 / 564058 ZFINID:ZDB-GENE-050808-2 Length:440 Species:Danio rerio


Alignment Length:439 Identity:122/439 - (27%)
Similarity:178/439 - (40%) Gaps:76/439 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 WAKDGGVHSEGLEIAIFPGYQLGLRATRPLAKDELVLSVPRKLILSEENNSDCRLFGKMTQATH- 187
            |..:.|..|:.|....|.....||.||:.:.....|:|:|.:.:|:...      ..|...|.: 
Zfish    40 WLNERGFTSQSLIPVNFHDTGRGLMATQTIKAKNSVISLPEECLLTTST------VLKSYMADYI 98

  Fly   188 ----------LNLAYDLVIEKIRGEFSEWRPYIDVLPAKYNTVLYFTTKQMELL-RGTAAAALAM 241
                      |.|...|:.|:..||.|||.||||:||..|...|||....:||| |.....|...
Zfish    99 KRWHPPISPLLALCCFLISERHHGEASEWNPYIDILPKTYTCPLYFPDNVIELLPRSLQKKATQQ 163

  Fly   242 RQCRVIAKQYAFLYKYAHTMTEPSTGNRSHPGERGLFFTQHGLCYKLYRWAVSTVMTRQNLVPSE 306
            ::      |:..|:..:.|.........:.|.|.  .|:|..|     |||..:|.||...:..:
Zfish   164 KE------QFQELFSSSQTFFHSLQPLFNQPTEE--LFSQDAL-----RWAWCSVNTRTVYMEHD 215

  Fly   307 KQESEDGPKLISALIPYWDMANHRPGKITSFYATVSRQLECTAQEAVNTGEQF---FIYYGDRSN 368
            :.:.....|.:.||.||.|:.||.|.  ....|..:::..|....:||..::|   ||.||...|
Zfish   216 QSKYLSREKDVYALAPYLDLLNHCPN--VQVEAGFNKETRCYEIRSVNGCKKFQQAFINYGPHDN 278

  Fly   369 TDLLVHNGFVDPNNTK-----DYVNIRVGLSLTDALAAKRASILDKLNIRHTAELRVLP-APDFI 427
            ..||:..|||.|.|..     |...::|||...|....::.     |.::....||.|. ..|..
Zfish   279 HRLLLEYGFVAPCNPHSVVYVDLETLKVGLDEKDKQLKEKL-----LYLKDNDFLRNLTFGMDGP 338

  Fly   428 SKELLAFVRVFKMSAEQLDHWCSDLDRAGDLLHIDCALETDHETRTWQFLEDRLKLLLAVFNKEM 492
            |..|:..:|:..:..:|...|.|.|        :..|:..|.|  .| .:|..|||.     ..:
Zfish   339 SWRLMTALRLLSLKPQQYTRWKSVL--------LGAAVSQDRE--DW-CIESALKLC-----NNL 387

  Fly   493 HEADEVKELE----LKDGQE---IELMLFL--YRRLERSILA---GALQ 529
            .| |.||.||    ||:|..   :|.:..:  .||.|::||.   |.||
Zfish   388 TE-DNVKALERLAQLKEGANQSGLEQLCVVESLRREEQNILGHTRGLLQ 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Setd3NP_727144.1 SET_SETD3 119..378 CDD:380953 75/268 (28%)
Rubis-subs-bind 400..524 CDD:370401 33/133 (25%)
setd4NP_001039027.1 Rubis-subs-bind 313..427 CDD:286371 33/135 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1337
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1321
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.