DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Setd3 and SETD4

DIOPT Version :9

Sequence 1:NP_727144.1 Gene:Setd3 / 31638 FlyBaseID:FBgn0052732 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_059134.1 Gene:SETD4 / 54093 HGNCID:1258 Length:440 Species:Homo sapiens


Alignment Length:423 Identity:98/423 - (23%)
Similarity:160/423 - (37%) Gaps:70/423 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 WAKDGGVHSEGLEIAIFPGYQLGLRATRPLAKDELVLSVPRKLILSEENNSDCRLFGKMTQ---- 184
            |.|........|..|.|||...||.:...|.:.::::|:|...:|:.:......|...:|:    
Human    39 WLKARKFQDSNLAPACFPGTGRGLMSQTSLQEGQMIISLPESCLLTTDTVIRSYLGAYITKWKPP 103

  Fly   185 -ATHLNLAYDLVIEKIRGEFSEWRPYIDVLPAKYNTVLYFTTKQMELLRGTAAAALAMRQCRVIA 248
             :..|.|...||.||..|..|.|:||:::||..|...:....:.:.||..:..|....::..|  
Human   104 PSPLLALCTFLVSEKHAGHRSLWKPYLEILPKAYTCPVCLEPEVVNLLPKSLKAKAEEQRAHV-- 166

  Fly   249 KQYAFLYKYAHTMTEPSTGNRSHPGERGLFFTQHGL---------CYKLYRWAVSTVMTRQNLVP 304
             |..|                  ...|..|.:...|         .|....||..||.||...:.
Human   167 -QEFF------------------ASSRDFFSSLQPLFAEAVDSIFSYSALLWAWCTVNTRAVYLR 212

  Fly   305 SEKQESEDGPKLISALIPYWDMANHRPG-KITSFYATVSRQLECTAQEAVNTGEQFFIYYGDRSN 368
            ..::|.........||.||.|:.||.|. ::.:.:...:...|..........|:.||.||...|
Human   213 PRQRECLSAEPDTCALAPYLDLLNHSPHVQVKAAFNEETHSYEIRTTSRWRKHEEVFICYGPHDN 277

  Fly   369 TDLLVHNGFVDPNNTKD--YVNIRV---GLSLTDALAAKRASILDKLNIRHTAELRVLPAPDFIS 428
            ..|.:..|||..:|...  ||:..:   .|..||....|:.|||..    |.....:....|..|
Human   278 QRLFLEYGFVSVHNPHACVYVSREILVKYLPSTDKQMDKKISILKD----HGYIENLTFGWDGPS 338

  Fly   429 KELLAFVRVFKMSAEQLDHWCSDLDRAGDLLHIDCALETDHETR-------TWQFLEDRLKLLLA 486
            ..||..:::..:.||:...|...|  .|:::.     :|:.:|.       .:.|:|:    ..|
Human   339 WRLLTALKLLCLEAEKFTCWKKVL--LGEVIS-----DTNEKTSLDIAQKICYYFIEE----TNA 392

  Fly   487 VFNKEMHEADE----VKELELKDG---QEIELM 512
            |..|..|..||    :.:|.|.:.   :|::::
Human   393 VLQKVSHMKDEKEALINQLTLVESLWTEELKIL 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Setd3NP_727144.1 SET_SETD3 119..378 CDD:380953 63/268 (24%)
Rubis-subs-bind 400..524 CDD:370401 27/127 (21%)
SETD4NP_059134.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
SET <210..273 CDD:279228 13/62 (21%)
Rubis-subs-bind 317..425 CDD:286371 26/122 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1337
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1321
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.