DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Setd3 and setd6

DIOPT Version :9

Sequence 1:NP_727144.1 Gene:Setd3 / 31638 FlyBaseID:FBgn0052732 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_955894.1 Gene:setd6 / 322348 ZFINID:ZDB-GENE-030131-1067 Length:460 Species:Danio rerio


Alignment Length:421 Identity:89/421 - (21%)
Similarity:166/421 - (39%) Gaps:100/421 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 EPLSQAV--CPQISDSPDDQTRLAKVEAFSAWAKDGGVHSEGLEIAIFPGYQLGLRATRPLAKDE 157
            |||:..:  |..:..:..|:..|:|               ||      ...:.|:.|...:.:..
Zfish    18 EPLNNFLLWCESVQLTLSDKVYLSK---------------EG------TAAEYGMLAKEDIEEGH 61

  Fly   158 LVLSVPRKLILSE---------ENNSDCRLFGKMTQATHLNLAYDLVIEKIRGEFSEWRPYIDVL 213
            ::.::||:.:|.:         |....|...........|:|.|:..     ...|.|:||:.:.
Zfish    62 VLFTIPREALLHQGTTKVKKVLEEGKKCLESASGWVPLLLSLMYEYT-----SSTSHWKPYLSLW 121

  Fly   214 PAKYNTV---LYFTTKQME-LLRGTAAAALAMRQCRVIAKQYAFLYKYAHTMTEPSTGNRSHPG- 273
            | .:.|:   ::::.::.: ||:||......:...|.:..:|       :::..|..  :|||. 
Zfish   122 P-DFRTLDQPMFWSEEECDKLLKGTGIPESVITDLRKLQDEY-------NSVVLPFM--KSHPDL 176

  Fly   274 ---ERGLFFTQHGLCYKLYRWAVSTVM--TRQNLVPSEKQESEDGPKL--ISALIPYWDMANHRP 331
               |:      |.|  :||:..|:.||  :.|..|..:.::.||..|.  :..::|..||.||  
Zfish   177 WDPEK------HNL--ELYKSLVAFVMAYSFQEPVEDDDEDEEDDEKKPNLPMMVPMADMLNH-- 231

  Fly   332 GKITSFYATVSRQLEC---TAQEAVNTGEQFFIYYGDRSNTDLLVHNGFVD--PNNTKDYVNIRV 391
              |:...|.:....||   .:...:..||:.|..||..:|..||...||.:  |||..:..:|::
Zfish   232 --ISKHNANLEYTPECLKMVSIRRIGKGEEVFNTYGQMANWQLLHMYGFAEPFPNNINETADIKM 294

  Fly   392 GLSLTDALA------AKRASILDKLNIRHTAELRVL---------PAPDFISKELLAFVRVFKMS 441
            . |:..|.|      |.:..:.||..:  ..|:.|:         .:......||...::|..||
Zfish   295 A-SVYKAAAQVARSEANQQLLEDKWKM--LCEMEVVGEKGVFIFGQSGSLTYHELYTTLKVLCMS 356

  Fly   442 AE------QLDHWCSDLDRAGDLLHIDCALE 466
            ::      :.:.|..|.:...|.:..|.:.|
Zfish   357 SQIFEDFRENEGWEEDDEDDDDKMEQDLSFE 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Setd3NP_727144.1 SET_SETD3 119..378 CDD:380953 59/282 (21%)
Rubis-subs-bind 400..524 CDD:370401 16/88 (18%)
setd6NP_955894.1 SET <226..265 CDD:279228 11/42 (26%)
Rubis-subs-bind 317..449 CDD:286371 13/73 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1321
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.