DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Setd3 and Setd4

DIOPT Version :9

Sequence 1:NP_727144.1 Gene:Setd3 / 31638 FlyBaseID:FBgn0052732 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_663457.2 Gene:Setd4 / 224440 MGIID:2136890 Length:439 Species:Mus musculus


Alignment Length:434 Identity:105/434 - (24%)
Similarity:165/434 - (38%) Gaps:65/434 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 WAKDGGVHSEGLEIAIFPGYQLGLRATRPLAKDELVLSVPRKLILSEENNSDCRLFG------KM 182
            |.|:.......|..|.|||...||.:...|.:.::::|:|...:|:.:......| |      |.
Mouse    38 WLKERKFEDTDLVPASFPGTGRGLMSKASLQEGQVMISLPESCLLTTDTVIRSSL-GPYIKKWKP 101

  Fly   183 TQATHLNLAYDLVIEKIRGEFSEWRPYIDVLPAKYNTVLYFTTKQMELLRGTAAAALAMRQCRVI 247
            ..:..|.|...||.||..|..|.|:.|:|:||..|...:....:.::||.....|....::.|| 
Mouse   102 PVSPLLALCTFLVSEKHAGCRSLWKSYLDILPKSYTCPVCLEPEVVDLLPSPLKAKAEEQRARV- 165

  Fly   248 AKQYAFLYKYAHTMTEPSTGNRSHPGERGLFFTQHGL---------CYKLYRWAVSTVMTRQNLV 303
              |..|                  ...||.|.|...|         .|:.:.||..||.||...:
Mouse   166 --QDLF------------------TSARGFFSTLQPLFAEPVDSVFSYRAFLWAWCTVNTRAVYL 210

  Fly   304 PSEKQESEDGPKLISALIPYWDMANHRPG-KITSFYATVSRQLECTAQEAVNTGEQFFIYYGDRS 367
            .|.:||.........||.|:.|:.||.|. ::.:.:...:|..|..........::.||.||...
Mouse   211 RSRRQECLSAEPDTCALAPFLDLLNHSPHVQVKAAFNEKTRCYEIRTASRCRKHQEVFICYGPHD 275

  Fly   368 NTDLLVHNGFVDPNNTKDYVNIRVGLSLTDALAAKRASILDKLNI--RHTAELRVLPAPDFISKE 430
            |..||:..|||...|....|.:...: |...|.|....:..|:.|  .|.....:....|..|..
Mouse   276 NQRLLLEYGFVSVRNPHACVPVSADM-LVKFLPAADKQLHRKITILKDHGFTGNLTFGWDGPSWR 339

  Fly   431 LLAFVRVFKMSAEQLDHWCSDLDRAGDLLHIDCALETDHETR---TWQFLEDRLKLLLAVFNKEM 492
            ||..:::..:.||:...|...|  .|:::.     :|:.:|.   ..:...|.::...||..|  
Mouse   340 LLTALKLLCLEAERFTSWKKVL--LGEVIS-----DTNEKTSLGVAQKICSDVIEETHAVLRK-- 395

  Fly   493 HEADEVKE--------LELKDGQEIELMLFLYRRLERSILAGAL 528
              ..::||        |.|.:...:|.:..|....|  ||:|.|
Mouse   396 --VSDMKEGTVSLRSQLSLVEALRMEELRILQASAE--ILSGLL 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Setd3NP_727144.1 SET_SETD3 119..378 CDD:380953 69/269 (26%)
Rubis-subs-bind 400..524 CDD:370401 26/136 (19%)
Setd4NP_663457.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
SET_SETD4 49..286 CDD:380954 67/258 (26%)
Rubis-subs-bind 313..424 CDD:370401 23/121 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1321
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.