DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht11 and Chi3l1

DIOPT Version :9

Sequence 1:NP_572361.1 Gene:Cht11 / 31630 FlyBaseID:FBgn0029913 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_001296749.1 Gene:Chi3l1 / 89824 RGDID:620874 Length:391 Species:Rattus norvegicus


Alignment Length:408 Identity:126/408 - (30%)
Similarity:199/408 - (48%) Gaps:63/408 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 GFIGLGLLGIQTGEVHKVGQRLVCYYAS-------DGTHNLSLLDVPGDLCTHINIGPATLDNAT 105
            ||..|.||  |:...:|    |||||.:       :|:.....||  ..|||||....|.:.|..
  Rat    17 GFAVLMLL--QSCSAYK----LVCYYTNWSQYREGNGSCFPDALD--HSLCTHIIYSFANISNNK 73

  Fly   106 IVLPDTLRQVLQNDTRSFRAAHPQVHLLLWIGGADSG-RSFALMVANHAMRKLFLRSLREILRTY 169
            :...:.....|.....:.:..:|::..||.:||...| ..|:.:|:|...||.|::|:...||||
  Rat    74 LSTSEWNDVTLYGMLNTLKTRNPRLKTLLSVGGWSFGSERFSRIVSNAKSRKTFVQSVAPFLRTY 138

  Fly   170 PSLDGIDLDWEFPSAYDRERMHLSQLLYEIRTEWRREKRTND---ILSLAVAAPEGIAFYAYDIR 231
             ..||:||.|.:|...|::  |.:.|:.|::.|:.:|.:...   :||.||:|.:......||:.
  Rat   139 -GFDGLDLAWLYPGPKDKQ--HFTTLIKELKAEFTKEVQPGTEKLLLSAAVSAGKVTLDSGYDVA 200

  Fly   232 EINLYADYVNLMSYDFHFYREDTPFTGLNAPLYARSQERSLMATFNINYTVQWWLKSGLEPQRLV 296
            :|..:.|::|||:||||.....|  ||.::||:...|:.......|::|.|.:.|:.|....:||
  Rat   201 QIAQHLDFINLMTYDFHGTWRHT--TGHHSPLFRGQQDTGPDRFSNVDYGVGYMLRLGAPTNKLV 263

  Fly   297 VGLPTYGHSFTLVNPLNHRIGAPASGYGKCGQLGFTTLTETCECVTKFFKPNLSYDAESCS---- 357
            :|:||:|.||||.:..| ::|||.:|.|..|:            .|| .|..|:| .|.|.    
  Rat   264 MGIPTFGKSFTLASSEN-QVGAPITGSGLPGR------------YTK-EKGTLAY-YEICDFLRG 313

  Fly   358 -----------PYLSALQEWISYENQTSIACKANYVKSLNLGGVMVFSLNTDDLKNS-CSIMPNL 410
                       |:.:...:|:.|::..|:..|..|:|:..|.|.||::::.||.:.| |      
  Rat   314 AEVHRILGQQVPFATKGNQWVGYDDPESVKNKVKYLKNKQLAGAMVWAVDLDDFRGSFC------ 372

  Fly   411 KYSEKPVFPLTQAIKDIL 428
              .....||||.|||:.|
  Rat   373 --GHNVHFPLTNAIKEAL 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht11NP_572361.1 Glyco_18 68..398 CDD:214753 107/355 (30%)
GH18_chitinase-like 69..428 CDD:299167 118/385 (31%)
Chi3l1NP_001296749.1 Glyco_18 31..365 CDD:214753 108/359 (30%)
GH18_chitolectin_chitotriosidase 32..388 CDD:119351 118/385 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58170
OrthoDB 1 1.010 - - D264489at33208
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.