DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht11 and CTS2

DIOPT Version :9

Sequence 1:NP_572361.1 Gene:Cht11 / 31630 FlyBaseID:FBgn0029913 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_010659.1 Gene:CTS2 / 851977 SGDID:S000002779 Length:511 Species:Saccharomyces cerevisiae


Alignment Length:297 Identity:86/297 - (28%)
Similarity:133/297 - (44%) Gaps:68/297 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 LLLWIGGADSGRSFALMVANHAMRKLFLRSLREILRTYPSLDGIDLDWEFPSAYDRE-------- 188
            :::.|||.....:|.:::.:..:.:.|:.|..|.:... ..||||||||||...:.|        
Yeast   176 VIMSIGGWSDSENFKIIIKDDKLLQNFVDSSVETMFRL-GFDGIDLDWEFPGNNESEPRGYLKLV 239

  Fly   189 ---RMHLSQLLYEIRTEWRREKRTNDILSLAVAAPEGIAF----YAYDIREINLYADYVNLMSYD 246
               |:.|:.|..:|     ..|||.|...|::|||   ||    :...|.||:.|.||.|:|:||
Yeast   240 RMLRLKLNSLESQI-----FGKRTEDHFQLSIAAP---AFKDKLFYLPITEIDQYVDYWNMMTYD 296

  Fly   247 FHFYREDTPFTGLNAPLYARSQERSLMATFNINYTVQWWLKSGLEPQRLVVGLPTYGHSF----- 306
            ::....:|  ||.::.|::   |..|...|.::|.:.   :.|:..::||:|:..||.||     
Yeast   297 YYGSWSET--TGYHSNLFS---ETELNGNFAMHYMID---RFGVNSRKLVLGMAAYGRSFHIKDN 353

  Fly   307 ---------TLVNPLNHRIGAPA----SGYGKCGQLGFTTLTE--TCECVTKFFKPNLSYDAESC 356
                     .|:|.:...:|.|.    ...||.|...:..|.:  |.|          .||.:..
Yeast   354 KFEPFNQNTVLINKIFKGVGKPTKEIDKADGKEGIWPYKNLPKIGTIE----------QYDPKYV 408

  Fly   357 SPYLSALQE----WISYENQTSIACKANYVKSLNLGG 389
            |.|  ...|    :|||:|..|:..||.||...||||
Yeast   409 SAY--CFDEKNSIFISYDNTKSVKTKAEYVTHNNLGG 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht11NP_572361.1 Glyco_18 68..398 CDD:214753 86/297 (29%)
GH18_chitinase-like 69..428 CDD:299167 86/297 (29%)
CTS2NP_010659.1 ChiA 36..474 CDD:225862 86/297 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 1 1.000 - - otm46727
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.770

Return to query results.
Submit another query.