DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht11 and AT4G19800

DIOPT Version :9

Sequence 1:NP_572361.1 Gene:Cht11 / 31630 FlyBaseID:FBgn0029913 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_193715.1 Gene:AT4G19800 / 827724 AraportID:AT4G19800 Length:398 Species:Arabidopsis thaliana


Alignment Length:330 Identity:94/330 - (28%)
Similarity:146/330 - (44%) Gaps:34/330 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 DVPGDLCTHINIGPATL--DNATIVLPDTLRQVLQNDTRSFRAAHPQVHLLLWIGGADSGR-SFA 146
            |:...|.||:....|.|  ::..|.:....:......|.:.:..:|.|..||.|||.::.: :||
plant    22 DIDSSLFTHLFCTFADLEAESYEITIATWNQAPFHAFTETVQQRNPHVKTLLSIGGGNADKDAFA 86

  Fly   147 LMVANHAMRKLFLRSLREILRTYPSLDGIDLDWEFPSAYDRERMHLSQLLYEIRTEWRR--EKRT 209
            .|.:|...|..|::|...:.|:| ...|:|||||:|.  :.|.|:....|.|   |||.  |..:
plant    87 SMASNPDSRASFIQSTITVARSY-GFHGLDLDWEYPR--NEEEMYDFGKLLE---EWRSAVEAES 145

  Fly   210 ND------ILSLAVAAPEGIAFYAYDIREINLYADYVNLMSYDFHFYREDTPFTGLNAPLYARSQ 268
            |.      ||:.||..........|.:..|:...|::|||:|||:.....| .||..|.||..:.
plant   146 NSSGTTALILTAAVYYSSNYQGVPYPVLAISNSLDWINLMAYDFYGPGWST-VTGPPASLYLPTD 209

  Fly   269 ERSLMATFNINYTVQWWLKSGLEPQRLVVGLPTYGHSFTLVNPLNHRIGAPASG--YGKCGQLGF 331
            .||      .:..|:.|.::||..::.|:|.|.||.::||.:|..:...|..:|  ....|::.:
plant   210 GRS------GDSGVRDWTEAGLPAKKAVLGFPYYGWAWTLADPDVNGYDANTTGPAISDDGEISY 268

  Fly   332 TTLTE--TCECVTKFFKPNLSYDAESCSPYLSALQEWISYENQTSIACKANYVKSLNLGGVMVFS 394
            ..|..  .....||.      :|......|..|...||.|:::.||..|..|.|...|.|...:.
plant   269 RQLQTWIVDNGATKV------HDDMMVGDYCYAGTTWIGYDSEKSIVTKVIYAKQKGLLGYFSWH 327

  Fly   395 LNTDD 399
            :..||
plant   328 VGGDD 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht11NP_572361.1 Glyco_18 68..398 CDD:214753 92/327 (28%)
GH18_chitinase-like 69..428 CDD:299167 94/330 (28%)
AT4G19800NP_193715.1 GH18_plant_chitinase_class_V 4..337 CDD:119358 94/330 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58170
OrthoDB 1 1.010 - - D826687at2759
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11177
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.890

Return to query results.
Submit another query.