DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht11 and AT4G19770

DIOPT Version :9

Sequence 1:NP_572361.1 Gene:Cht11 / 31630 FlyBaseID:FBgn0029913 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_193712.2 Gene:AT4G19770 / 827721 AraportID:AT4G19770 Length:261 Species:Arabidopsis thaliana


Alignment Length:269 Identity:76/269 - (28%)
Similarity:121/269 - (44%) Gaps:41/269 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 MVANHAMRKLFLRSLREILRTYPSLDGIDLDWEFPSAYDRERMHLSQLLYEIRTEWR----REKR 208
            |.::...||.|:.|...|.|:| ..||:|||||:|    |....:|... |:..|||    .|..
plant     1 MASSSYGRKSFILSTISIARSY-GFDGLDLDWEYP----RNAAEMSDFA-ELLKEWRYAVQGEAY 59

  Fly   209 TNDILSLAVAAPEGIAFYA-------YDIREINLYADYVNLMSYDFHFYREDTPFTGLNAPLYAR 266
            ::::..|.:.|   ..:|:       |.::.|:...|:||:.:||| :....|..||..|.||.:
plant    60 SSELPVLILTA---TVYYSSNYNGVVYPVKFISELLDWVNIKAYDF-YGPGCTEVTGPPAALYLQ 120

  Fly   267 SQERSLMATFNINYTVQWWLKSGLEPQRLVVGLPTYGHSFTLVNPLNHRIGAPASG--YGKCGQL 329
            |...|      .:..|:.|:.:||..::.|:|.|.||.::||.:|.||......:|  ....|::
plant   121 SDGPS------GDSGVKDWIDAGLPAEKAVLGFPYYGWAWTLADPKNHGYYVDTTGPAISDDGEI 179

  Fly   330 GFTTLTETCECVTKFF----KPNLSYDAESCSPYLSALQEWISYENQTSIACKANYVKSLNLGGV 390
            .::.|        |.:    |....:|......|..|...||.|:::.||..|..|.|...|.|.
plant   180 SYSQL--------KTWIVDNKATTVHDNIVIGDYCYAGTTWIGYDSEESIVTKVIYAKQKGLLGY 236

  Fly   391 MVFSLNTDD 399
            ..:.:..||
plant   237 FSWQVGGDD 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht11NP_572361.1 Glyco_18 68..398 CDD:214753 74/266 (28%)
GH18_chitinase-like 69..428 CDD:299167 76/269 (28%)
AT4G19770NP_193712.2 GH18_chitinase-like <1..250 CDD:299167 76/269 (28%)
Glyco_18 <1..244 CDD:214753 74/266 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58170
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.