DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht11 and AT4G19750

DIOPT Version :9

Sequence 1:NP_572361.1 Gene:Cht11 / 31630 FlyBaseID:FBgn0029913 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_193710.2 Gene:AT4G19750 / 827719 AraportID:AT4G19750 Length:362 Species:Arabidopsis thaliana


Alignment Length:332 Identity:87/332 - (26%)
Similarity:137/332 - (41%) Gaps:52/332 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 THINIGPATLDNAT--IVLPDTLRQVLQNDTRSFRAAHPQVHLLLWIGGADSGRS-FALMVANHA 153
            ||:....|.:|::|  :.:.......:.:.|.:.:..:..|..||.|||.|:.:: .|.|.:|..
plant    38 THLFCAFADVDSSTHEVTISAANSCQVSSFTHTVKDKNTDVQTLLSIGGKDADKAVLASMASNSK 102

  Fly   154 MRKLFLRSLREILRTYPSLDGIDLDWEFPSAYDRERMHLSQLLYEIRTEWR-----REKRTNDIL 213
            .||.|:.|..:|.|. ....|:||.||:|| .|.|..:..:|:    .|||     ...|||.:.
plant   103 NRKAFIDSSIDIARK-KDFYGLDLAWEYPS-NDVEMANFGKLV----KEWRAAVVEESDRTNQLP 161

  Fly   214 SLAVAAPEGIAFYA-------YDIREINLYADYVNLMSYDFHFYRED-TPFTGLNAPLY------ 264
            .|..||    .:|:       |.::.|....|:||:|:||  ||... :|.||..|.|:      
plant   162 LLLTAA----VYYSPDYYGEEYPVQAIADNLDFVNIMAYD--FYGPGWSPVTGPPAALFDPSNPA 220

  Fly   265 ARSQERSLMATFNINYTVQWWLKSGLEPQRLVVGLPTYGHSFTLVNPLNHRIGAPASGYGKCGQL 329
            .||.:..|..          ||::.|..::.|:|....|.::||.:..|:...|...| ......
plant   221 GRSGDSGLSK----------WLEAKLPAKKAVLGFSYCGWAWTLEDAENNGYDAATDG-AAISSD 274

  Fly   330 GFTTLTETCECVTKFFKPN---LSYDAESCSPYLSALQEWISYENQTSIACKANYVKSLNLGGVM 391
            |..|..:    :..:...|   ..:|......|......||.|::..||..|..|.|...|.|..
plant   275 GSITYAK----IRNYIIDNGAATFHDPAVIGFYCYVGTTWIGYDDNQSIVSKVRYAKLKGLLGYF 335

  Fly   392 VFSLNTD 398
            .:.:..|
plant   336 SWHVGAD 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht11NP_572361.1 Glyco_18 68..398 CDD:214753 86/330 (26%)
GH18_chitinase-like 69..428 CDD:299167 87/332 (26%)
AT4G19750NP_193710.2 GH18_plant_chitinase_class_V 11..348 CDD:119358 87/332 (26%)
Glyco_18 14..342 CDD:214753 86/330 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58170
OrthoDB 1 1.010 - - D826687at2759
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11177
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.890

Return to query results.
Submit another query.