DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht11 and chia.1

DIOPT Version :9

Sequence 1:NP_572361.1 Gene:Cht11 / 31630 FlyBaseID:FBgn0029913 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_998215.1 Gene:chia.1 / 406323 ZFINID:ZDB-GENE-040426-1994 Length:455 Species:Danio rerio


Alignment Length:410 Identity:121/410 - (29%)
Similarity:195/410 - (47%) Gaps:64/410 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 GLG-LLGIQTGEVHKVGQRLVCYYASDGTHNLSLLDVPGD-----------LCTHINIGPATL-- 101
            ||| ||.:|...    ..:||||..:...:.      ||:           ||||:....||:  
Zfish     9 GLGILLSLQIVS----STKLVCYMTNWSQYR------PGNGKFLPENIDPFLCTHVVYALATISY 63

  Fly   102 DN--ATIVLPDTLRQVLQNDTRSFRAAHPQVHLLLWIGGADSGRS-FALMVANHAMRKLFLRSLR 163
            ||  .||...|.   .|.......:..:|.:...|.:||..:|.| :..|||....||.|:|:..
Zfish    64 DNQITTIEWNDV---DLYKSMNELKKVNPALKTQLSVGGLVNGVSPYINMVATPENRKAFIRNAL 125

  Fly   164 EILRTYPSLDGIDLDWEFP---SAYDRERMHLSQLLYEIRTEWRRE----KRTNDILSLAVAAPE 221
            ..||.: ..||:|:||::|   .:..:::..|:..:.|:|....:|    |:|..:||:.|:|.:
Zfish   126 LFLRLH-EFDGMDIDWQYPGHNGSPPQDKQRLTTFIKEMRDAIEQEAIDTKKTPLLLSIKVSAIK 189

  Fly   222 GIAFYAYDIREINLYADYVNLMSYDFHFYREDTPFTGLNAPLYARSQERSLMATFNINYTVQWWL 286
            .....||:.:|:....|:|.:||||:|.:.:  |.||.|:||:..|.:...:...|||.::::||
Zfish   190 TTIENAYEAKEVASLVDFVTIMSYDYHGHWD--PITGHNSPLFRSSFDTGSIVHHNINSSLEFWL 252

  Fly   287 KSGLEPQRLVVGLPTYGHSFTLVNPLNHRIGAPASGYGKCG----QLGFTTLTETCECVTKFFKP 347
            .||....||::||||||.:| :::.....:||||:|....|    :.||.:..|.|...:..   
Zfish   253 GSGAPADRLLLGLPTYGRTF-MLSTSQTGLGAPANGPADAGPYTREAGFWSYYEICPMESSV--- 313

  Fly   348 NLSYDAESCSPYLSALQEWISYENQTSIACKANYVKSLNLGGVMVFSLNTDD------------- 399
            .:.:..|...||....:.|:.::||.||..|..::.||.|||..|::|:.||             
Zfish   314 PIHWIDEQMVPYAVQGRAWVGFDNQESITAKVQWLNSLKLGGASVWTLDFDDFAGRFCYNGAYPL 378

  Fly   400 ---LKNSCSIMPNLKYSEKP 416
               |:||....|....:.:|
Zfish   379 VNHLRNSLGFPPKPTTTPRP 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht11NP_572361.1 Glyco_18 68..398 CDD:214753 108/356 (30%)
GH18_chitinase-like 69..428 CDD:299167 115/391 (29%)
chia.1NP_998215.1 Glyco_18 23..364 CDD:214753 108/356 (30%)
GH18_chitolectin_chitotriosidase 24..386 CDD:119351 112/377 (30%)
ChtBD2 407..455 CDD:214696
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58170
OrthoDB 1 1.010 - - D264489at33208
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.