DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht11 and btb-18

DIOPT Version :9

Sequence 1:NP_572361.1 Gene:Cht11 / 31630 FlyBaseID:FBgn0029913 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_872066.2 Gene:btb-18 / 353391 WormBaseID:WBGene00018201 Length:298 Species:Caenorhabditis elegans


Alignment Length:176 Identity:39/176 - (22%)
Similarity:66/176 - (37%) Gaps:56/176 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 LLGIQTGEVHKVGQRLVCYYA------------SDGTHNLSLLDVP----GDLCTHINIGPATLD 102
            :|.|...::| |.:..:||::            .|.:..:.|.||.    |.|.:.|:..|...:
 Worm   143 VLVIGERKLH-VNKDFLCYHSDHFRELFFSNLKKDASVEIELRDVVYEDFGHLMSTIHPNPVFPN 206

  Fly   103 NATI----VLPDTLRQVLQNDTRSFRAAHPQVHLL----------LWIGGADSGRSFALMVANHA 153
            :.::    ||.|..:.....|       |.:.|||          :|            |...:.
 Worm   207 DRSVEKILVLADRFKVQSAID-------HVEHHLLHNSRLANECMMW------------MADKYG 252

  Fly   154 MRKLFLRSLREI--LRTYPSLDGIDLDWEFPS-AYDRERMHLSQLL 196
            |:||...|::.|  |....:|....|   |.| :::.:.|.|.|||
 Worm   253 MKKLLKISIQNIGSLENAKNLKNSTL---FASLSHNAKVMVLEQLL 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht11NP_572361.1 Glyco_18 68..398 CDD:214753 35/162 (22%)
GH18_chitinase-like 69..428 CDD:299167 35/161 (22%)
btb-18NP_872066.2 BTB 141..237 CDD:197585 22/101 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.