DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht11 and chia.4

DIOPT Version :9

Sequence 1:NP_572361.1 Gene:Cht11 / 31630 FlyBaseID:FBgn0029913 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_956740.1 Gene:chia.4 / 337333 ZFINID:ZDB-GENE-030131-9279 Length:475 Species:Danio rerio


Alignment Length:404 Identity:114/404 - (28%)
Similarity:197/404 - (48%) Gaps:47/404 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 GLGLLGIQTGEVHKVGQRLVCYYASDGTHNLSL-----LDVPGDLCTHINIGPATLDNATIVLPD 110
            |:.|...|.|    :..:|.||:|:...:...:     .:|...||||:....:.::     :.:
Zfish     9 GISLALCQCG----LASQLACYFANWSQYRPDVGKYMPSNVDPHLCTHLIYAFSVIN-----IKN 64

  Fly   111 TLRQVLQNDT---RSFRA---AHPQVHLLLWIGGADSGRS-FALMVANHAMRKLFLRSLREILRT 168
            .|.....||.   :||.|   ::|.:..||.:|..:.|.: |:.||:....|:.|:.|..:.|||
Zfish    65 KLATSEWNDETLYQSFNALKQSNPNLKTLLAVGTLNLGSTQFSRMVSTPQKRQTFIESSIKFLRT 129

  Fly   169 YPSLDGIDLDWEFPSA-----YDRERMHL--SQLLYEIRTEWRREKRTNDILSLAVAAPEGIAFY 226
            : ..||:|||||:|.:     .|:.|..|  .:||...:.|.:..:|...:|:.||||.:||...
Zfish   130 H-GFDGLDLDWEYPGSGESPPEDKHRFTLLCKELLKAYQAESKATRRPRLMLTAAVAARKGIIDA 193

  Fly   227 AYDIREINLYADYVNLMSYDFHFYREDTPFTGLNAPLYARSQERSLMATFNINYTVQWWLKSGLE 291
            .|:|.|::.|.|::|:|:||||...|:.  ||.|:|||..|::......:|.::.:.:|...|..
Zfish   194 GYEIAEVSKYLDFINIMTYDFHGSWENV--TGHNSPLYRDSRDTGDQIYYNTDFAMTYWRDQGAP 256

  Fly   292 PQRLVVGLPTYGHSFTLVNPLNHRIGAPASGYGKCG----QLGFTTLTETCECVTKFFKPNLSYD 352
            .::|.:|...||.:|.|.:.:| .:|||.||....|    :.|:.:..|.|   |...:.::...
Zfish   257 VEKLRMGFAAYGRTFCLSSAVN-GLGAPVSGPASAGTYTREAGYWSYYEIC---TFLQRASVEQI 317

  Fly   353 AESCSPYLSALQEWISYENQTSIACKANYVKSLNLGGVMVFSLNTDDLKNSCSIMPNLKYSEKPV 417
            |:...||.:....|:.:::|.|...|.:|:|....||..|:||:.||...        ::..:..
Zfish   318 ADQKVPYATEGLNWVGFDDQKSYETKVDYLKEKGFGGAFVWSLDLDDFSG--------QFCGQGK 374

  Fly   418 FPLTQAIKDILRES 431
            :||...:..:|..|
Zfish   375 YPLIGHLHTLLNIS 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht11NP_572361.1 Glyco_18 68..398 CDD:214753 104/352 (30%)
GH18_chitinase-like 69..428 CDD:299167 108/381 (28%)
chia.4NP_956740.1 Glyco_18 22..363 CDD:214753 104/352 (30%)
GH18_chitolectin_chitotriosidase 25..381 CDD:119351 107/375 (29%)
ChtBD2 425..473 CDD:214696
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58170
OrthoDB 1 1.010 - - D264489at33208
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.