DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht11 and chia.6

DIOPT Version :9

Sequence 1:NP_572361.1 Gene:Cht11 / 31630 FlyBaseID:FBgn0029913 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_955897.2 Gene:chia.6 / 322420 ZFINID:ZDB-GENE-030131-1140 Length:480 Species:Danio rerio


Alignment Length:391 Identity:109/391 - (27%)
Similarity:186/391 - (47%) Gaps:37/391 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 VGQRLVCYYASDGTHNLSL-----LDVPGDLCTHINIGPATLDNAT-IVLPDTLRQVLQNDTRSF 123
            :..:||||:.:...:...:     .:|...||||:....:.::|.. :...:...:.|.......
Zfish    19 LASQLVCYFTNWSQYRPDVGKYMPSNVDPHLCTHLIYAFSIINNENKLTTYEWNDETLYQSFNGL 83

  Fly   124 RAAHPQVHLLLWIGGADSGRS-FALMVANHAMRKLFLRSLREILRTYPSLDGIDLDWEFPSA--- 184
            :.::|.:..||.:||.:.|.: |:.||:....|:.|::|....|||: ..||:|||||:|.:   
Zfish    84 KQSNPNLKTLLAVGGWNFGTTQFSSMVSTPQNRQTFIQSSITFLRTH-GFDGLDLDWEYPGSRGS 147

  Fly   185 --YDRERMHL--SQLLYEIRTEWRREKRTNDILSLAVAAPEGIAFYAYDIREINLYADYVNLMSY 245
              .|::|..|  .:|:...:.|.....|...:|:.||||.:|.....|:|.||..|.|::|:|:|
Zfish   148 PPEDKQRFTLLCKELVEAYQAESAATGRPRLMLTAAVAAGKGNIDAGYEIAEIAKYLDFINIMTY 212

  Fly   246 DFHFYREDTPFTGLNAPLYARSQERSLMATFNINYTVQWWLKSGLEPQRLVVGLPTYGHSFTLVN 310
            |||...|..  ||.|:|||..|.:......:|.::.:.:|...|...::|.:|...||.:|.|.:
Zfish   213 DFHGSWESV--TGHNSPLYRGSGDIGDKIYYNTDFAMTYWRDQGAPVEKLRMGFAAYGRTFRLSS 275

  Fly   311 PLNHRIGAPASGYGKCG----QLGFTTLTETCECVTKFFKPNLSYDAESCSPYLSALQEWISYEN 371
            .:: .:||||||....|    :.||.:..|.|   |...:..:....:...||.:..|||:.::|
Zfish   276 AVS-GVGAPASGAASAGTYTREAGFWSYYEIC---TFLKQATVQQIVDQKVPYATKGQEWVGFDN 336

  Fly   372 QTSIACKANYVKSLNLGGVMVFSLNTDDLKNS-CS-----------IMPNLKYSEKPVFPLTQAI 424
            ..|...|.:|:|....||..|::|:.||.... |.           .:.|:..:|.|..|.:..:
Zfish   337 MESYKTKVDYLKEKGFGGAFVWALDLDDFSGQFCGQSKYPLIGQLRTLLNINNTEFPYNPPSTTV 401

  Fly   425 K 425
            |
Zfish   402 K 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht11NP_572361.1 Glyco_18 68..398 CDD:214753 101/347 (29%)
GH18_chitinase-like 69..428 CDD:299167 109/387 (28%)
chia.6NP_955897.2 Glyco_18 22..363 CDD:214753 101/347 (29%)
GH18_chitolectin_chitotriosidase 23..385 CDD:119351 104/368 (28%)
CBM_14 433..479 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58170
OrthoDB 1 1.010 - - D264489at33208
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.