DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht11 and Cht6

DIOPT Version :9

Sequence 1:NP_572361.1 Gene:Cht11 / 31630 FlyBaseID:FBgn0029913 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_001245598.1 Gene:Cht6 / 31935 FlyBaseID:FBgn0263132 Length:4611 Species:Drosophila melanogaster


Alignment Length:431 Identity:134/431 - (31%)
Similarity:222/431 - (51%) Gaps:65/431 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 WSALLFSLLCLCLGFIGLGLLGIQTGEVHKVGQRLVCYYAS-----DGTHNLSLLDVPGDLCTHI 94
            |..|.  |||         .|.....|....| |:||||.:     .||...:..::...||||:
  Fly    10 WQTLF--LLC---------ALAYCINEASSEG-RVVCYYTNWSVYRPGTAKFNPQNINPYLCTHL 62

  Fly    95 --NIGPATLDNATIVLP-DTLRQVLQNDTRSF---RAAHPQVHLLLWIGGADSGRS-FALMVANH 152
              ..|..|.||.  :.| |..:.:.|.....|   :..:.|:..::.|||.:...| |:.:||::
  Fly    63 VYAFGGFTKDNQ--MKPFDKYQDIEQGGYAKFTGLKTYNKQLKTMIAIGGWNEASSRFSPLVASN 125

  Fly   153 AMRKLFLRSLREILRTYPSLDGIDLDWEFPS----AYDRERMHLSQLLYEIRTEWRREK----RT 209
            ..|:.|::::.:.|| ....||||||||:|:    ...|:|.:.:|.:.|:|.|:.||.    ||
  Fly   126 ERRQQFIKNILKFLR-QNHFDGIDLDWEYPAHREGGKSRDRDNYAQFVQELRAEFEREAEKTGRT 189

  Fly   210 NDILSLAVAAPEGIAFY--AYDIREINLYADYVNLMSYDFHFYREDTPFTGLNAPLYA--RSQER 270
            ..:|::||  |.||.:.  .||:.::|.|.|:.|:::||||...|  |....:||||:  ...|.
  Fly   190 RLLLTMAV--PAGIEYIDKGYDVPKLNKYLDWFNVLTYDFHSSHE--PSVNHHAPLYSLEEDSEY 250

  Fly   271 SLMATFNINYTVQWWLKSGLEPQRLVVGLPTYGHSFTLVNPLNHRIGAPASGYGKCG----QLGF 331
            :..|..||:|:::::||:|.:..:||:|:||||.|:||:|..:..:||||.|.|:.|    :.|:
  Fly   251 NYDAELNIDYSIKYYLKAGADRDKLVLGIPTYGRSYTLINEESTELGAPAEGPGEQGDATREKGY 315

  Fly   332 TTLTETCECVT-----KFFKPNLSYDAESCSPYLSALQEWISYENQTSIACKANYVKSLNLGGVM 391
            ....|.|:.:.     ...:||    |....||.....:|:.|:::..:..||.||.:..|||:|
  Fly   316 LAYYEICQTLKDDPEWTVVQPN----ANVMGPYAYRRNQWVGYDDEAIVRKKAEYVVAQGLGGIM 376

  Fly   392 VFSLNTDDLKNSCSIMPNLKYSEKPVFPLTQAIKDILRESL 432
            .::::.||.:.:|:..|         :||.:|.|:.:.|:|
  Fly   377 FWAIDNDDFRGTCNGKP---------YPLIEAAKEAMVEAL 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht11NP_572361.1 Glyco_18 68..398 CDD:214753 116/362 (32%)
GH18_chitinase-like 69..428 CDD:299167 123/391 (31%)
Cht6NP_001245598.1 Glyco_18 31..383 CDD:214753 116/362 (32%)
GH18_chitolectin_chitotriosidase 32..404 CDD:119351 123/391 (31%)
CBM_14 506..562 CDD:279884
Oxidored_q2 <2691..2750 CDD:294335
CBM_14 4554..4609 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264489at33208
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 1 1.000 - - otm46727
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.