DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht11 and Muc96D

DIOPT Version :9

Sequence 1:NP_572361.1 Gene:Cht11 / 31630 FlyBaseID:FBgn0029913 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_733106.2 Gene:Muc96D / 318737 FlyBaseID:FBgn0051439 Length:881 Species:Drosophila melanogaster


Alignment Length:97 Identity:21/97 - (21%)
Similarity:31/97 - (31%) Gaps:19/97 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   310 NPLNHRIGAPASGYGKCGQLGFTTLTETCECVTKFFKPN--LSYDAESCSPYLSALQEWISYENQ 372
            ||:|..:...|...|.........|..:|     ..||:  |....|.|:.|...     .::..
  Fly   799 NPVNRLLWEVAEWAGLSSSSSEAQLKVSC-----LGKPDGFLMASPERCNDYYIC-----RHQRA 853

  Fly   373 TSIACKANYVKSLNLGGVMVFSLNTDDLKNSC 404
            ..::|...|...|.  |:.....||     ||
  Fly   854 LKVSCGDRYFNGLK--GICDLPENT-----SC 878

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht11NP_572361.1 Glyco_18 68..398 CDD:214753 18/89 (20%)
GH18_chitinase-like 69..428 CDD:299167 21/97 (22%)
Muc96DNP_733106.2 ChtBD2 29..72 CDD:214696
CBM_14 827..875 CDD:279884 11/59 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.