DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht11 and Chil6

DIOPT Version :9

Sequence 1:NP_572361.1 Gene:Cht11 / 31630 FlyBaseID:FBgn0029913 Length:432 Species:Drosophila melanogaster
Sequence 2:XP_017175043.1 Gene:Chil6 / 229688 MGIID:2682303 Length:452 Species:Mus musculus


Alignment Length:431 Identity:128/431 - (29%)
Similarity:201/431 - (46%) Gaps:69/431 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 SALLFSLLCLCLGFIGLG-LLGIQTGEVHKVGQRLVCYYASDGTHNLSLLDVPGD-----LCTHI 94
            |.|:|        .:||. ||..|.|..:    :|:||:.:...|...:.|:..:     ||||:
Mouse    19 SKLVF--------IMGLNLLLNAQMGSAY----QLMCYFNNWPQHQPDVRDIKHEDIDPCLCTHL 71

  Fly    95 NIGPATL--DNATIVLPDTLRQVLQNDTRSFRAAHPQVHL---------------LLWIGGADSG 142
            ....|.:  :|.|:    |.|:.| :|.:.|.....:.||               ||.||..:.|
Mouse    72 IYSFAGIWENNFTM----TKRKEL-DDYKGFNDLKKRQHLWRFIHASFRNNKLKTLLSIGCWNFG 131

  Fly   143 -RSFALMVANHAMRKLFLRSLREILRTYPSLDGIDLDWEFPSAY---DRERMHLSQLLYEIRTEW 203
             .||..||:....|..|:.|:.:.||.| ..||::|.|::|..|   .|::...:.|::|||..:
Mouse   132 DGSFITMVSTPENRHSFITSIIKFLRKY-GFDGLNLAWQYPGCYGSPPRDKHLFTILMHEIRKAF 195

  Fly   204 RRE----KRTNDILSLAVAAPEGIAFYAYDIREINLYADYVNLMSYDFHFYREDTPFTGLNAPLY 264
            .:|    |:...:::.|||.......:.|:|.:::...||:.:|:||.|...:.  :||.|:|||
Mouse   196 EKEVSKNKKPRLMVTAAVAGVISTIQFGYEIPQLSQSLDYIQVMTYDLHGSWDG--YTGENSPLY 258

  Fly   265 ARSQERSLMATFNINYTVQWWLKSGLEPQRLVVGLPTYGHSFTLVNPLNHRIGAPASGYGKCG-- 327
            ....|..:.|..||.|.:..|.|.|..|::|:||.|.|||:|.|.:.....||||::..|..|  
Mouse   259 KSPIETGVKAFHNIKYIMDNWKKKGASPEKLIVGFPAYGHTFILSDSTKTEIGAPSNRGGHPGPH 323

  Fly   328 --QLGFTTLTETCECVTKFFKPNL--SYDAESCSPYLSALQEWISYENQTSIACKANYVKSLNLG 388
              |.||....|.|    .|.|...  .::|....||.....||:.|:|..|...||.::|..|.|
Mouse   324 TKQTGFWAYYEIC----TFLKNGAIQVWNAAQQVPYAFHGNEWVGYDNIKSFHIKAQWLKRNNYG 384

  Fly   389 GVMVFSLNTDDLKNSCSIMPNLKYSEKPVFPLTQAIKDILR 429
            |.|:::::.||...|        :..:..||||..:|..|:
Mouse   385 GAMIWTIDMDDYTGS--------FCGQGTFPLTSILKKTLK 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht11NP_572361.1 Glyco_18 68..398 CDD:214753 110/365 (30%)
GH18_chitinase-like 69..428 CDD:299167 118/394 (30%)
Chil6XP_017175043.1 GH18_chitolectin_chitotriosidase 41..416 CDD:119351 118/394 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58170
OrthoDB 1 1.010 - - D264489at33208
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.