DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht11 and Chil5

DIOPT Version :9

Sequence 1:NP_572361.1 Gene:Cht11 / 31630 FlyBaseID:FBgn0029913 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_001074285.1 Gene:Chil5 / 229687 MGIID:2676649 Length:431 Species:Mus musculus


Alignment Length:400 Identity:115/400 - (28%)
Similarity:195/400 - (48%) Gaps:50/400 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 LLGIQTGEVHKVGQRLVCYYASDGTHNLSL-----LDVPGDLCTHINIGPATLDNATIVLPDTLR 113
            ||..|.|..:    :|:|||.:...:...|     .|:...||||:....|.:.|..:    |:|
Mouse    13 LLNPQLGSAY----QLMCYYNNVAQNRPKLGSFNPADIDPCLCTHLIYAFAGMQNNKV----TMR 69

  Fly   114 QVLQNDTRSFRAAHP------QVHLLLWIGGADSGRS-FALMVANHAMRKLFLRSLREILRTYPS 171
            .:  ||...::|.:.      |:..||.|||.|.|.: |:.||:....::.|:.|..:.||.| .
Mouse    70 SM--NDLTDYQALNTLKSRNVQLKTLLAIGGRDFGPAPFSAMVSTPHNQQTFINSAIKFLRQY-G 131

  Fly   172 LDGIDLDWEFPSAY---DRERMHLSQLLYEIRTEWRREKRTND----ILSLAVAAPEGIAFYAYD 229
            .||::|||:||.:.   .|::...:.|:.:||..:..|...|.    :::..||.........|:
Mouse   132 FDGLNLDWQFPGSRGSPSRDKHLFTVLVQKIREAFELEAIENKSPRLMVTATVAGVISTIQSGYE 196

  Fly   230 IREINLYADYVNLMSYDFHFYREDTPFTGLNAPLYARSQERSLMATFNINYTVQWWLKSGLEPQR 294
            |.:::.:.||:.:|:|:.|..::.  :||.|:|||....:..:....|::|.:.:|.::|..|::
Mouse   197 IPQLSHFLDYIQVMTYNLHGSQDG--YTGENSPLYKSLNDTGINTLLNVDYIMTYWNENGAAPEK 259

  Fly   295 LVVGLPTYGHSFTLVNPLNHRIGAPASGYGKCG----QLGFTTLTETCECVTKFFKPNL--SYDA 353
            |:||.|.||.:|||.:|.|:.|.||.:..|..|    :.|.....|.|    .|.....  ::|:
Mouse   260 LIVGFPAYGQTFTLSDPSNNGISAPTASAGTLGPYTEESGTWAYYEIC----SFLNDGATEAWDS 320

  Fly   354 ESCSPYLSALQEWISYENQTSIACKANYVKSLNLGGVMVFSLNTDDLKNSCSIMPNLKYSEKPVF 418
            ....||.....:|:.|:|..|...||.::|..||||.|:::|:.||...|        :..:..|
Mouse   321 AQEVPYAYQGNKWVGYDNVKSFRIKAEWLKQNNLGGAMLWTLDMDDFTGS--------FCNQGQF 377

  Fly   419 PLTQAIKDIL 428
            |||..:|:.|
Mouse   378 PLTSTLKNAL 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht11NP_572361.1 Glyco_18 68..398 CDD:214753 102/354 (29%)
GH18_chitinase-like 69..428 CDD:299167 110/383 (29%)
Chil5NP_001074285.1 GH18_chitolectin_chitotriosidase 24..387 CDD:119351 110/383 (29%)
Glyco_18 26..365 CDD:214753 101/351 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4712
OMA 1 1.010 - - QHG58170
OrthoDB 1 1.010 - - D264489at33208
OrthoFinder 1 1.000 - - FOG0000107
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.980

Return to query results.
Submit another query.