DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht11 and chil-9

DIOPT Version :9

Sequence 1:NP_572361.1 Gene:Cht11 / 31630 FlyBaseID:FBgn0029913 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_001366720.1 Gene:chil-9 / 191470 WormBaseID:WBGene00014162 Length:460 Species:Caenorhabditis elegans


Alignment Length:360 Identity:79/360 - (21%)
Similarity:159/360 - (44%) Gaps:64/360 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 GQRLVCYYASDGTHNLSLLDVPGDLCTHINIGPATLDNATIVL-PDTLRQVLQNDTRSFRAAHPQ 129
            |:|:|.|:|.  ..|.:|......:.|||....|...|.||.. .::..|..:...|:.|.|...
 Worm   111 GKRIVGYFAE--FENTALTRKQLRMLTHIVFLFAFPKNGTITFGGESSSQKFEEMRRNVRKASST 173

  Fly   130 VHLLLWIGGADSGRSFALMVANHAMRKLFLRSLREILRTYPSLDGIDLDWEFPSAYDRER--MHL 192
            :.:::.|||..:...|:.:|:|...|.||:.|:...:|.| .:||:|:.|.:|...|...  |.:
 Worm   174 LKVMISIGGQYNSGEFSGLVSNETSRNLFVNSIATFVRDY-DIDGVDIFWTWPKHSDENNYLMFI 237

  Fly   193 SQLLYEIRTEWRRE--KRTNDILSLAVAAPEGIAFYAYDIREINLYADYVNLMSYDFHFYREDTP 255
            .:|.|.. ||.:::  ::...::||.::....   :...:.|.:.:.|::|:.|::.:.|:    
 Worm   238 RELRYAF-TELQKKLNRKETFVISLVISRNVN---HLSKLVEFSNFVDFINIYSFNSYLYQ---- 294

  Fly   256 FTGLNAPLYARSQERSLMATFNINYTVQWWL-KSGLEPQR--LVVG----------LPTYGHSFT 307
             .|.::|||.....       |::..::::: |:| :|.:  ::|.          ||....|..
 Worm   295 -VGPDSPLYGGGSR-------NVDEIMKYYICKTG-QPSKFNIIVSFHATYWEGAELPLRDDSDD 350

  Fly   308 LVNPLNHRIGAPASGYGKCGQLGFTTLTETCECVTKFFKPNLSYDAESCSPYLSALQEWI----- 367
            :....|...|..|..:.:..|             .|:...|:.:...:.:.|:     ||     
 Worm   351 IFKDQNSAKGGFAVRWRELLQ-------------QKWDMSNIKFHNLTKTSYM-----WIPGPPT 397

  Fly   368 ---SYENQTSIACKANYVKSLNLGGVMVFSLNTDD 399
               :.|::.|:..|..||...|:||:.:::::.||
 Worm   398 RFMTLEDEKSLREKNRYVADHNIGGITMWTIDQDD 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht11NP_572361.1 Glyco_18 68..398 CDD:214753 76/355 (21%)
GH18_chitinase-like 69..428 CDD:299167 77/357 (22%)
chil-9NP_001366720.1 Glyco_18 113..431 CDD:214753 76/355 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.