DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht11 and chil-27

DIOPT Version :9

Sequence 1:NP_572361.1 Gene:Cht11 / 31630 FlyBaseID:FBgn0029913 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_496035.1 Gene:chil-27 / 188616 WormBaseID:WBGene00011848 Length:407 Species:Caenorhabditis elegans


Alignment Length:247 Identity:52/247 - (21%)
Similarity:99/247 - (40%) Gaps:53/247 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NYEKLDGSSAGRITDELSRKEQRNCSLRTLVCWSALLFSLLCLCLGFIGLGLLGIQTGEVHKVGQ 67
            ||.|:.........|.::..|  |||...:   ...:|.|:.:|:              |.....
 Worm     6 NYIKISIDEKNDRRDNVTANE--NCSRNRI---KKGIFVLIGICV--------------VFAFAN 51

  Fly    68 RLVCYYASDGTHNLSLLDVP---GDLCTHINIGPA----TLDNATIVLPDTLRQVL--------- 116
            ..:.:.|.:...:.|  ::|   .|:.:...|.|.    |..:.:...||.:..||         
 Worm    52 NAMGHPAKENDESSS--EIPPIENDIASTTQIIPTVPLLTDSSGSEKPPDKVTFVLFAADRIGFD 114

  Fly   117 -----QNDTRSFRAAHPQVHL-------LLWIGGADSGRSFALMVANHAMRKLFLRSLREILRTY 169
                 .:.:|:|.....:..:       ||.|||..:.:...|::|:...::.|.:|:..||..|
 Worm   115 GSVEVDHSSRTFSKLKEKSKIESSHFKKLLSIGGRSNTQFLPLVIADPRRKRRFFKSIISILEEY 179

  Fly   170 PSLDGIDLDWEFPSAYDRERMHLSQLLYEIRTEWRREKRTNDILSLAVAAPE 221
             .|||:||.|::  |.:......|:.|.|::.: .:|::.|.:||:.:...|
 Worm   180 -QLDGVDLLWKW--AKNSNTKKCSRFLCELKQK-LKERKKNYVLSVQILPDE 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht11NP_572361.1 Glyco_18 68..398 CDD:214753 40/182 (22%)
GH18_chitinase-like 69..428 CDD:299167 40/181 (22%)
chil-27NP_496035.1 Glyco_hydro_18 89..>228 CDD:279094 34/143 (24%)
GH18_chitinase-like 97..>235 CDD:299167 33/135 (24%)
Glyco_hydro_18 261..>402 CDD:279094
GH18_chitinase-like 268..>407 CDD:299167
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.