DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht11 and chil-18

DIOPT Version :9

Sequence 1:NP_572361.1 Gene:Cht11 / 31630 FlyBaseID:FBgn0029913 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_496024.2 Gene:chil-18 / 187735 WormBaseID:WBGene00011161 Length:429 Species:Caenorhabditis elegans


Alignment Length:425 Identity:92/425 - (21%)
Similarity:177/425 - (41%) Gaps:81/425 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LSRK----EQRNCSLRTLVCWSALLFSLLCLCLGFIGLGLLGI----QTGEVHK--VGQRLVCYY 73
            |.||    |:|..|:.|.......:|:||.|    :.:|..|:    .:.::.|  ..:|:|.||
 Worm    15 LPRKEVHSEKRIPSILTRTIAVLFVFALLAL----VSIGSEGVPQLRNSRDLTKSPCKKRVVGYY 75

  Fly    74 AS-DGTHNLSLLDVPGDLCTHINIGPATLDNATIVLPDT--LRQVLQNDTRSF-------RAAHP 128
            :. :||.           .|...:|..|......:..|:  ..|...|....|       :.|:.
 Worm    76 SEWEGTE-----------ITRSQLGKLTHAVFAFIHMDSEGKLQFKTNQKERFEKLKTAVKNANS 129

  Fly   129 QVHLLLWIGGADSGRSFALMVANHAMRKLFLRSLREILRTYPSLDGIDLDWEFPSAYDRERMHLS 193
            ...:::.|||..:..:|..::::...:.:|:.|:...:|.: .:.|:|:.|::....:.|.....
 Worm   130 DTKVMISIGGDHNSENFGSVLSDSEKKSMFIDSIARFIRQH-KIHGVDIYWKWLGNSETEHHDFP 193

  Fly   194 QLLYEIRTEWRREKRTNDILSLAVAAP--------EGIAFYAYDIREINLYADYVNLMSYDFHF- 249
            ..|.:::   .:.|...|...:::.||        :|   |.:|  :...|.|:||:.|.|::. 
 Worm   194 SFLKDLK---EKLKTVRDDSIISIVAPQAKMDRRHDG---YKFD--DFMEYIDFVNVFSMDYYGP 250

  Fly   250 --YREDTPFTGLNAPLYARSQERSLMATFNINYTVQWWLKSGLEPQRLVVGLPTYGHSFTLV-NP 311
              .:..|| ||.:||||...   .:...||::.|::::.....:|.:..:.:|.|...:..| .|
 Worm   251 WPNQWGTP-TGPSAPLYGGI---GVKKHFNVDSTMKYYTCMTEDPSKFNMVIPFYVRLWKNVKEP 311

  Fly   312 LNH----------RIGAPASGYGKCGQLGFTTLTETCECVTKFFKPNLSYDAESCSPYL--SALQ 364
            ::.          :.||   ..|......:|...|..|     ..|.| :|..:.:||:  ....
 Worm   312 ISSGTEVFRRADLKNGA---AVGNSYMSRWTVDHEGWE-----LTPAL-WDDVTKTPYVWNQETG 367

  Fly   365 EWISYENQTSIACKANYVKSLNLGGVMVFSLNTDD 399
            .::::||:.||..|..|....|||||.:..::.|:
 Worm   368 NFLTFENKKSIEAKLAYAIEHNLGGVWIHLVDKDN 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht11NP_572361.1 Glyco_18 68..398 CDD:214753 77/363 (21%)
GH18_chitinase-like 69..428 CDD:299167 77/365 (21%)
chil-18NP_496024.2 Glyco_18 70..401 CDD:214753 77/363 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D826687at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.