DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht11 and K08F9.3

DIOPT Version :9

Sequence 1:NP_572361.1 Gene:Cht11 / 31630 FlyBaseID:FBgn0029913 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_001263897.1 Gene:K08F9.3 / 187168 WormBaseID:WBGene00010686 Length:287 Species:Caenorhabditis elegans


Alignment Length:231 Identity:50/231 - (21%)
Similarity:93/231 - (40%) Gaps:49/231 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 CWSALLFSLL--CLCLGFIGLGLLGI-----QTGEVH-----KVGQRLVCYYASDGTHNLSLLDV 86
            |.|.|...::  |..|.|:.:.:.||     .:|.|.     :..::|:.||  :|....::|:.
 Worm    77 CLSDLCGQIIMGCSVLLFLFVLIFGIYSLVSHSGHVQSTTPDQCDKQLIGYY--NGIEGRNILEN 139

  Fly    87 PGDLCTHINIGPATLDNATIVLPDTLRQVLQNDTRSFRAAHPQVHLL---LWIGGADSGRSFALM 148
            .....||     |...:..:           |:..||..:|.:...|   ..:|  :|..:..:|
 Worm   140 QFHNLTH-----AVFTSEFV-----------NENGSFENSHKEQEFLECRKKLG--ESNSTAKIM 186

  Fly   149 VA---NHAMRKLFLRSLREILRTYPSLDGIDLDWEFPSAYDRERMHLSQLLYEIRTEWRREKRTN 210
            :|   |....|  :..:...:..| .:||::|.|      :.....||||......:.|.:|.:|
 Worm   187 IAMGFNKGSCK--IDCITSFIEKY-QVDGVELHW------NHNEHFLSQLETTRNLKNRLKKISN 242

  Fly   211 DILSLAVAAPEGIAFYAYDIREINLYADYVNLMSYD 246
            ..| |.|:|....: ...::.::...||:||:..:|
 Worm   243 SKL-LGVSASSNWS-RVTELDQVLEVADFVNIELHD 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht11NP_572361.1 Glyco_18 68..398 CDD:214753 40/185 (22%)
GH18_chitinase-like 69..428 CDD:299167 40/184 (22%)
K08F9.3NP_001263897.1 Glyco_hydro_18 122..>272 CDD:279094 38/180 (21%)
GH18_chitinase-like 124..276 CDD:299167 39/182 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.