DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht11 and chil-7

DIOPT Version :10

Sequence 1:NP_572361.1 Gene:Cht11 / 31630 FlyBaseID:FBgn0029913 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_496131.2 Gene:chil-7 / 182437 WormBaseID:WBGene00007472 Length:482 Species:Caenorhabditis elegans


Alignment Length:49 Identity:8/49 - (16%)
Similarity:23/49 - (46%) Gaps:3/49 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 IAVLAVLFTVPSLYNT---INEVHDQVLDGVSVFRVETDSAWTEMMDIQ 60
            :||..::....:||:.   :..:..::.:.||:...|....:|.::..:
 Worm   246 LAVENLISEKEALYSEMKGLEMILQRIQESVSLMTEEDRKVFTSILTFE 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht11NP_572361.1 Glyco_18 68..398 CDD:214753
chil-7NP_496131.2 Glyco_18 127..453 CDD:214753 8/49 (16%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.