DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht11 and chil-6

DIOPT Version :9

Sequence 1:NP_572361.1 Gene:Cht11 / 31630 FlyBaseID:FBgn0029913 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_496126.1 Gene:chil-6 / 182436 WormBaseID:WBGene00007471 Length:460 Species:Caenorhabditis elegans


Alignment Length:387 Identity:80/387 - (20%)
Similarity:149/387 - (38%) Gaps:118/387 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 GQRLVCYYASDGTHNLSLLDVPGDLCTHINIGPATLDNATIVLPDTLRQVLQNDTRSF------- 123
            |:|:|.|:|......||...:  .:.|||....|...|.::...|      ::..|.|       
 Worm   111 GKRIVGYFAEFENSPLSKKQL--QMLTHIIYLFAIPKNGSLTFRD------ESSRRKFVAMKNEA 167

  Fly   124 RAAHPQVHLLLWIGGADSGRSFALMVANHAMRKLFLRSLREILRTYPSLDGIDLDWEFPSAYDRE 188
            |.....:.:::.|||..|...|:.:|:....|.||..|:...::.| .:||:|:.|.:|...|..
 Worm   168 RKESSTLKVMISIGGQYSSGEFSGLVSKETSRNLFTNSIVSFVQNY-DIDGVDIFWTWPKYSDEN 231

  Fly   189 R--MHLSQLLYEIRTEWRRE--KRTNDILSLAVAAPEGIAFYAYDIREINLYADYVNLMSYDFHF 249
            .  |.:.:|.|.. ||.:::  ::...::||.::....   :..::.|.:.:.|::|:  |.|:.
 Worm   232 NYLMFIRELRYAF-TELQKKLNRKETFVISLVISRNVN---HLSNLVEFSNFVDFLNI--YLFNS 290

  Fly   250 YREDTPFTGLNAPLY---ARSQERSLM---------ATFNI--NYTVQWWLKSGLE--------- 291
            :...   .|.::|||   :|..:.::.         :.|||  ::...:|  :|.|         
 Worm   291 FLNQ---IGPDSPLYGGGSRIVDENMKYYICKSGQPSKFNIIVSFHATYW--NGAELPLRDDSDD 350

  Fly   292 ------PQRLVVGLP-----TYGHSFTLVNPLNHRIGAPASGYGKCGQLGFTTLTETCECVTKFF 345
                  ..||.:.||     .|..:.|                    .:.|..||:|        
 Worm   351 IWKDNNSGRLPIALPRRQLRQYNWNLT--------------------DIKFHNLTKT-------- 387

  Fly   346 KPNLSYDAESCSPYLSALQEWI--------SYENQTSIACKANYVKSLNLGGVMVFSLNTDD 399
                ||             .||        :.|.:.|:..|..||...|:||:.:::::.||
 Worm   388 ----SY-------------IWIPGPPTRFMTLEEERSLREKNRYVADHNIGGITMWTIDQDD 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht11NP_572361.1 Glyco_18 68..398 CDD:214753 77/382 (20%)
GH18_chitinase-like 69..428 CDD:299167 78/384 (20%)
chil-6NP_496126.1 Glyco_18 113..431 CDD:214753 77/382 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58170
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.