DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cht11 and chil-2

DIOPT Version :9

Sequence 1:NP_572361.1 Gene:Cht11 / 31630 FlyBaseID:FBgn0029913 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_496133.2 Gene:chil-2 / 182431 WormBaseID:WBGene00007466 Length:383 Species:Caenorhabditis elegans


Alignment Length:368 Identity:77/368 - (20%)
Similarity:153/368 - (41%) Gaps:89/368 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 QRLVCYYASDGTHNLSLLDVPGDLCTHINIGPATLDNATIVLPDTLRQVLQNDTRSFRAAHPQVH 131
            |:.|..|::....|..|..:...:.|.|:|.|    |.||..|:.  :..::..|..:..:|.:.
 Worm    40 QKRVVAYSAKFLSNHQLKKLTHFIFTSISIFP----NGTIKWPNC--ENFESYARKAKMDNPNLK 98

  Fly   132 LLLWIGGADSGRSFALMVANHAMRKLFLRSLREILRTYPSLDGIDLDWEFPSAYDRERMHLSQLL 196
            :::.|.|     .|..::|....:..|::|:...:..: ..||:|:.|.:|.  |.:..||    
 Worm    99 IMVEING-----KFFSVLAEDEKKNSFIKSISSFVVDH-KFDGVDIFWSWPE--DEDTFHL---- 151

  Fly   197 YEIRTEWRREKRTNDILSLAVAAPEGIAFYAYDIREINL-----YADYVNLMSYDFHFYREDTPF 256
              ...|:|.:...:.|:|:|:..      .|..:...||     :.|::|::|.:   |.|..|.
 Worm   152 --FIKEFREKLEKHMIISIAIPR------LAQQLEGFNLKLLMNHIDFLNVLSIN---YYEPLPG 205

  Fly   257 TGLN----APLYARSQ--------------ERSLMATFNINYTVQWW--LKSGLEPQRLVVGLPT 301
            .|.|    :|||...:              :|..:....:.:|..:|  :|.||..|..:     
 Worm   206 NGANIGPISPLYGGQRGNVDGTLKYLTCITKRPSILNMGVTFTGIFWNGVKDGLNEQDDI----- 265

  Fly   302 YGHSFTLVNPLNHRIGAPASGYGKCGQLGFTTLTETCECVTKFFK------PNLSYDAESCSPYL 360
                        .::....:|.||  .:|:          .||.|      |.....::|...:.
 Worm   266 ------------WKVAQNENGPGK--SIGW----------RKFIKDRRNTIPQWHDSSKSSYAWD 306

  Fly   361 SALQEWISYENQTSIACKANYVKSLNLGGVMVFSLNTDDLKNS 403
            ...:.::::||:.|::.|..||::.|:||:::::::.||..||
 Worm   307 PKSKIFLAFENEKSLSEKVIYVRNKNIGGLVIWNVDQDDNDNS 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cht11NP_572361.1 Glyco_18 68..398 CDD:214753 72/360 (20%)
GH18_chitinase-like 69..428 CDD:299167 76/366 (21%)
chil-2NP_496133.2 Glyco_18 42..344 CDD:214753 72/359 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.